KEGG   Nocardioides sp. JS614: Noca_3595Help
Entry
Noca_3595         CDS       T00443                                 

Definition
(GenBank) response regulator receiver
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
nca  Nocardioides sp. JS614
Pathway
nca02020  Two-component system
nca02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:nca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Noca_3595
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Noca_3595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:nca02022]
    Noca_3595
   02035 Bacterial motility proteins [BR:nca02035]
    Noca_3595
Two-component system [BR:nca02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Noca_3595
Bacterial motility proteins [BR:nca02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Noca_3595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-ProteinID: ABL83095
UniProt: A1SMR0
Position
complement(3814319..3814681)
Genome map
AA seq 120 aa AA seqDB search
MKIIIADDSRVMRQIVLRTLRQAGFGHHDFVEATDGADALDKVATERPDLVLSDWNMPNK
TGIELLRDLRGSGNAVPFGFVTSEGSDEMRKTAAEAGALFLIAKPFTPEHFESALAGMLG
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcatcatcgccgacgacagccgggtcatgcgccagatcgtgctgcgcacgctg
cgccaggccggcttcgggcaccacgacttcgtggaggccaccgacggtgccgacgcactc
gacaaggtcgccacggagaggcccgacctggtgctctcggactggaacatgccgaacaag
acggggatcgagctgctccgcgacctgcgcggcagcggcaacgccgtcccgttcgggttc
gtcacctccgagggctccgacgagatgcgcaagaccgccgcggaagcgggcgcgctgttc
ctcatcgccaagccgttcacccccgagcacttcgagtccgcgctcgccggcatgctgggc
tga

DBGET integrated database retrieval system