KEGG   Nocardioides sp. JS614: Noca_3597Help
Entry
Noca_3597         CDS       T00443                                 

Definition
(GenBank) response regulator receiver
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
nca  Nocardioides sp. JS614
Pathway
nca02020  Two-component system
nca02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:nca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Noca_3597
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Noca_3597
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:nca02022]
    Noca_3597
   02035 Bacterial motility proteins [BR:nca02035]
    Noca_3597
Two-component system [BR:nca02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Noca_3597
Bacterial motility proteins [BR:nca02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Noca_3597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg DUF2868 YlzJ
Motif
Other DBs
NCBI-ProteinID: ABL83097
UniProt: A1SMR2
Position
complement(3815164..3815559)
Genome map
AA seq 131 aa AA seqDB search
MRALIVDDSRAMRRIVGRILVDAGFEVLEAGDGQEALDVLAAQDGNLPVLACVDWNMPVM
DGLTFITEVRKQVEWRAITLMMVTTESEQDRIVRALAAGAHEYLIKPFTGDALVEKLDLL
GLTPTTVGDPV
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccttgattgtcgatgactcccgagcgatgcggcggatcgtcggtcgcatcctg
gtcgatgccggcttcgaggtcctcgaggccggtgacggccaggaggcgctcgacgtcctc
gccgcccaggacgggaacctgcccgtcctggcatgcgtggactggaacatgcccgtgatg
gacggcctgacgttcatcaccgaggtccgcaagcaggtcgagtggcgcgccatcaccttg
atgatggtgaccaccgagagcgagcaggaccggatcgtgcgcgcgctggctgcaggggcg
cacgagtacctgatcaagccgttcaccggcgacgccctcgtggagaagctcgacctgctc
gggctgaccccgacgaccgtgggagatcccgtatga

DBGET integrated database retrieval system