KEGG   Nocardioides sp. JS614: Noca_3600Help
Entry
Noca_3600         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABL83100
UniProt: A1SMR5
Position
complement(3817577..3818482)
Genome map
AA seq 301 aa AA seqDB search
MPYSLLGGHAIGFDLARLGRGRQAAAVLRTALTADVADLDAWAAQHPGPVRRSDWLRAAA
RADERAATVRSMLPLAGAAVEEAVTTGASTLLRRLETSLLGDTHALDHFVRHELLDWTWI
HSGPMSVQDPTASAAADVLSDAAVSGFLGDRLDPGVRRALVAPYLRADLPTRDETASTGM
GRLDRVLDRLADGDEEVRAAWRRVVDENRVRTAEWAPAMHQASWAVSMAGRLRLACDAQL
AGVIAFQLAGLTPRDAAYGVWNAVSGVLQAVAIADLLPATASTVLLRPWHLVYGEGPIFG
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccgtactccctgctgggcggacatgcgatcgggttcgacctcgcccggctcggccgt
ggtcgccaggcggccgccgtcctgcggaccgcgctcaccgctgacgtcgcagacctggac
gcgtgggccgcgcagcacccgggaccggtgcgccggagcgactggctgcgggccgccgca
cgcgccgacgagcgggcggccaccgtccggtcgatgctgcccctggccggcgcggccgtc
gaggaggccgtcacgaccggggcgtccacgctcctgcgtcgcctcgagacgagcctgctc
ggtgacacgcacgccctggaccacttcgtccggcacgagctcctggactggacctggatc
cactccggcccgatgagcgtgcaggacccgaccgcttcggccgccgcggacgtgctgtcc
gacgccgcggtcagcggcttcctcggggaccggctcgacccgggagtgcggcgcgcgctg
gtcgcgccgtacctgcgcgcggacctgccgacccgcgacgagacggcctcgaccgggatg
ggccgcctcgaccgggtgctcgaccggctggccgacggcgacgaggaggtccgggccgcc
tggcgccgggtcgtggacgagaaccgggtgcgcacggccgagtgggcgccggcgatgcac
caggcgagctgggcggtgtcgatggccggtcggctgcggctcgcctgcgacgcccagctc
gccggcgtcatcgccttccagctcgccgggctcacgccccgggacgcggcgtacggcgtc
tggaacgcggtctccggcgtcctgcaggcggtggcgatcgccgacctgctgccggccacc
gcctcgacggtgctgctgcgcccgtggcacctggtgtacggcgagggaccgatcttcggg
gcctga

DBGET integrated database retrieval system