KEGG   Nocardioides sp. JS614: Noca_3602Help
Entry
Noca_3602         CDS       T00443                                 

Definition
(GenBank) chemotaxis sensory transducer
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal HAMP 4HB_MCP_1 DUF3450
Motif
Other DBs
NCBI-ProteinID: ABL83102
UniProt: A1SMR7
Position
complement(3818828..3820384)
Genome map
AA seq 518 aa AA seqDB search
MNSPVTLTVGRRLAAIVGIGVVAGAVVGGSALLNLRAVDRDAEVIGKYQDARAYLYHLDT
RSAELKVDGLKAVAYPDNEAIAQDVVDDIATIDEIVGDIDALGLSITTPEFRQAWTDYET
AIGDFVDSAIANQSAARVNVEDVQTANDAMDVLLSAAIEKVDADTAAKESAADSARGRAA
TLLVAVGIVGMIVMSVIAWLIGRSITVPLRRSVDVLKGFAEGDLTQRAEERSTAELGELE
CALNASIDSVGGIISTVVGSADAVAAASEELSASSQQIAAGAEETSVQAGVVSGAAEEVS
RNVQTVAAGSEQMGASIREIAQSANEAARVASQAVSMVESTNETVGKLGASSQEIGNVVK
VITSIAEQTNLLALNATIEAARAGEAGKGFAVVANEVKELAQETARATEDIARRVEAIQA
DTGGAVDAIGQISAIIASINDYQLTIASAVEEQTATTNEMSRNVAEASTGSGEIAANISG
VAAAADTTTQAVNQTLTAIQELARMSQDLRSEVTRFRR
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcctgtcaccctgaccgtcggtcgtcgcctggccgcgatcgtcggcatcggc
gtcgtcgccggcgcggtcgtcggcggctcggcactcctcaacctccgtgcggtcgaccgg
gatgccgaggtgatcgggaagtaccaagacgcccgggcgtacctgtaccacctggacacg
cgctccgccgagctcaaggtcgacggcctcaaggccgtcgcctaccccgacaacgaggcg
atcgcgcaggacgtcgtggacgacatcgcgacgatcgacgagatcgtgggcgacatcgac
gcgctggggctgtcgatcacgactccggagttccgccaggcctggaccgactacgagacc
gcgatcggcgacttcgtggactccgcgatcgcgaaccagagcgcggcgcgcgtcaacgtc
gaggacgtgcagacggccaacgacgcgatggacgtgctgctctccgccgccatcgagaag
gtcgacgcggacacggccgccaaggagtcggccgcggactcggcccgcggccgtgcggcc
acgctgctggtcgccgtcggcatcgtcgggatgatcgtgatgtcggtgatcgcctggctg
atcgggcgctcgatcaccgtgccgctgcggcgcagcgtcgacgtgctgaagggcttcgcc
gagggcgacctgacgcagcgcgccgaggagaggtccaccgccgagctcggtgagctcgag
tgcgcgctgaacgcctccatcgactcggtcggcggcatcatcagcaccgtggtggggtcg
gcggatgcggtggcggctgcgtcggaggagttgtcggcgtcgtcgcagcagattgctgcg
ggtgcggaggagacctcggtgcaggccggtgtggtgtctggtgctgcggaggaggtctcg
cgcaacgtgcagacggtggctgctggttcggagcagatgggggcgtcgatccgggagatc
gcgcagtcggcgaacgaggcggcgcgggtggcgtcgcaggcggtgtcgatggtggagtcg
acgaacgagacggtgggcaagctgggggcgtcgagccaggagatcgggaacgtggtcaag
gtgatcacctcgatcgcggagcagacgaacctgttggcgttgaacgcgacgatcgaggcg
gctcgtgccggtgaggcgggcaaggggttcgcggtggtggccaacgaggtcaaggagctg
gcgcaggagacggcgcgggcgaccgaggacatcgcgcgtcgggtggaggcgatccaggcc
gataccggtggtgcggtggatgcgatcgggcagatctcggcgatcatcgcctcgatcaac
gactaccagctgacgatcgcgtcggcggtggaggagcagaccgcgacgacgaacgagatg
tcgcgcaatgtcgcggaggcctcgacgggctcgggtgagatcgcggcgaacatctccggc
gtcgccgccgccgccgacaccacgacgcaggcggtcaaccagaccctcaccgcgatccag
gagctggcccggatgtcccaggacctgcgctccgaggtcacccgcttccgccgctga

DBGET integrated database retrieval system