KEGG   Nocardioides sp. JS614: Noca_3608Help
Entry
Noca_3608         CDS       T00443                                 

Definition
(GenBank) PspC domain protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PspC DUF2154 Cyt_bd_oxida_II
Motif
Other DBs
NCBI-ProteinID: ABL83108
UniProt: A1SMS3
Position
3825670..3826929
Genome map
AA seq 419 aa AA seqDB search
MVRAPATEQAGAMTTTPPEAPSDPQSPHPTGSTGPRVDRDQVRDLGRLRRSVTDRKVAGV
AGGLGRHLDIDPLILRVAFVVLVFFGGAGLILYGACWLLVPEDGAVRAPFNLDERSRTVA
LVIVGVIAALALIGDSWGAFWFPWPLAIVALVVLWLLTRNNPPHPVPPVAPVPPSEPHAQ
TYAQTYAQTYHQPAPPPAQPTYYSPPPAYVPPATYVPRPPNPRKRGPILFWFTLALIVLA
EGVLGMIDLAGVGFADAAYPALAVGISGLMLVVGAFFGRAGGIIALGLLATVVLTGATAA
DRWDGDKVLETPPTAAAVDDRYWLGVGEQVIDLREVADLQRLDGRTIEVEGGVGHIEVIL
PVGLAATVRADVDGPGNIKVFDLERGGIDTTLNSYDGSQLDPAITIDAQLGVGQIEVHR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcgcccccgcgaccgagcaggctggtgccatgaccaccacaccgcccgaagca
ccatcggacccgcagtcaccgcaccccaccgggagcaccgggccgcgcgtcgaccgcgac
caggtccgcgacctcggccgcctgcgccgctccgtcaccgaccgcaaggtcgcgggcgtg
gccggtggcctcgggcggcacctggacatcgacccgctgatcctgcgggtggcgttcgtc
gtgctcgtgttcttcggcggcgccggcctgatcctgtacggcgcctgctggctgctcgtc
ccggaggacggggccgtccgggcgccgttcaacctcgacgagcgcagccggaccgtcgcg
ctggtcatcgtcggcgtgatcgccgccctcgccctgatcggcgactcctggggcgccttc
tggttcccgtggccgctcgcgatcgtggcgctggtcgtgctgtggctgctgacccgcaac
aacccgccgcatccggtgcccccggttgcgccggtcccgccgtccgagcctcacgcccag
acgtacgcccagacgtacgcccagacctaccaccagccggcaccgcctccggcccagccg
acgtactacagcccgccgccggcgtacgtgccgcccgcgacgtacgtgccgcggccgccg
aacccgcgcaagcgcggcccgatcctgttctggttcacgctcgcgctgatcgtgctggcc
gagggcgtcctcggcatgatcgacctcgccggcgtgggcttcgcggacgcggcgtacccc
gcgctcgccgtggggatctccgggctgatgctggtggtcggtgcgttcttcggccgggcc
ggcggcatcatcgcgctcggcctcctggccacggtcgtgctgaccggtgcgaccgctgca
gaccggtgggacggcgacaaggtcctcgagaccccgccgaccgcggcggccgtggacgac
cgctactggctgggcgtcggcgagcaggtcatcgacctgcgcgaggtcgccgacctccag
cggctcgacggccgcacgatcgaggtcgagggcggcgtcgggcacatcgaggtgatcctc
cccgtcggcctggccgccaccgtccgggccgacgtcgacggccccggcaacatcaaggtc
ttcgacctcgagcgcggcgggatcgacaccaccctgaactcctacgacgggtcgcagctc
gacccggcgatcaccatcgacgcccagctcggcgtcggacagatcgaggtgcaccgatga

DBGET integrated database retrieval system