KEGG   Nocardioides sp. JS614: Noca_3610Help
Entry
Noca_3610         CDS       T00443                                 

Definition
(GenBank) YbaK/prolyl-tRNA synthetase associated region
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_edit DUF4347
Motif
Other DBs
NCBI-ProteinID: ABL83110
UniProt: A1SMS5
Position
3827256..3827798
Genome map
AA seq 180 aa AA seqDB search
MSAPTLGSLETVPALDRPDLLADPVAAALRSWPGAAQIGVVEIDPAIADTAALAEAYDLP
MSTGANCVVVAGRRDGAERVAACLVRADSRADVNGLVKRTLDVRKASFLAMERAVEESGM
EYGGITPLGLPAGWRLLVDPQVLDIEVAVIGSGVRRSKLLLPGALAAELPGAEIVAGLAG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccgaccctcggctcgctggagaccgtccccgccctcgaccgtcccgacctg
ctcgcggaccccgtcgccgccgccctgcgctcctggccgggggccgcgcagatcggggtg
gtcgagatcgacccggcgatcgccgacaccgccgccctggccgaggcctacgacctgccg
atgtcgaccggcgcgaactgcgtcgtggtggccgggcgccgcgacggcgccgagcgggtc
gcggcgtgcctggtccgcgccgactcccgcgccgacgtcaacggcctggtcaagcgcacc
ctggacgtccgcaaggcctcgttcctggcgatggagcgcgcggtggaggagtcgggcatg
gagtacggcggcatcaccccgctcggcctccccgccggctggcggttgctggtcgatccg
caggtgctggacatcgaggtcgcggtgatcgggtcgggggtgcggcgctcgaagctgctg
ctccccggtgcgctggccgccgagctgcccggcgcagagattgtggcgggcctggctggg
taa

DBGET integrated database retrieval system