KEGG   Nocardioides sp. JS614: Noca_3613Help
Entry
Noca_3613         CDS       T00443                                 

Definition
(GenBank) acyl-CoA dehydrogenase domain protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_ox_N AgrD
Motif
Other DBs
NCBI-ProteinID: ABL83113
UniProt: A1SMS8
Position
3829380..3830528
Genome map
AA seq 382 aa AA seqDB search
MPEQPTILEQEHEDFRGTVRAFLEKEVVPHHEQWEKDGQVSREVWRKAGEHGLLCFDVEE
EYGGAGVKDFRYNMVVAEEMCRVGASGPGFPVHTDIIVPYISQLGTPEQKARWLPGLVSG
ELISAIAMTEPGAGSDLQGIKTTAIDKGDHYVLNGSKTFISNGILSDLVIVVCRTDPDAG
HQGISLLVVERGMKGFERGRNLDKMGMKAQDTAELFFDEVEVPKENLLGAEGSGFVSLMV
NLAQERISIAVMAVAAIEQMLEVSLSYAKDRQAFGKPIGSFQHNRFLLAEMATDAHIARV
FVNDCVLKLNAGQVDPALASMAKWWTTETQKKVVDQAVQLHGGYGYMMEYPVARAYVDSR
IQTIYGGTTEIQKEIIGRSLGI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcagccgacgattctcgagcaggagcacgaggacttccgcggcaccgtccgc
gccttcctggagaaggaggtcgtcccgcaccacgagcagtgggagaaggacggccaggtc
agccgcgaggtctggcgcaaggccggcgagcacggcctgctgtgcttcgacgtcgaggag
gagtacggcggcgccggggtcaaggacttccgctacaacatggtggtcgccgaggagatg
tgccgggtcggcgcgagcggccccggcttcccggtgcacaccgacatcatcgtcccctac
atcagccagctcgggacgcccgagcagaaggcccgctggctgcccggcctggtcagcggc
gagctcatctccgcgatcgcgatgaccgagccgggcgccggctcggacctgcagggcatc
aagaccacggcgatcgacaagggcgaccactacgtcctgaacggctcgaagacgttcatc
agcaacggcatcctctccgacctcgtgatcgtcgtgtgccgcaccgaccccgacgccggc
caccagggcatcagcctgctcgtggtcgagcgcgggatgaagggcttcgagcgcggccgc
aacctggacaagatggggatgaaggcccaggacaccgccgagctgttcttcgacgaggtc
gaggtccccaaggagaacctgctcggcgccgagggctccggcttcgtctcgctgatggtc
aacctcgcccaggagcggatctcgatcgccgtgatggcggtcgccgccatcgagcagatg
ctcgaggtctcgctgtcctacgccaaggaccggcaggccttcggcaagccgatcggcagc
ttccagcacaaccgcttcctgctcgccgagatggccaccgacgcccacatcgcccgggtg
ttcgtcaacgactgcgtgctcaagctcaacgccggccaggtcgaccccgccctcgcctcg
atggcgaagtggtggaccaccgagacccagaagaaggtcgtcgaccaggccgtccagctg
cacggcggctacggctacatgatggagtaccccgtcgcccgggcctacgtcgacagccgg
atccagaccatctacggcggcaccaccgagatccagaaggagatcatcggccgctcgctc
ggcatctga

DBGET integrated database retrieval system