KEGG   Nocardioides sp. JS614: Noca_3614Help
Entry
Noca_3614         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABL83114
UniProt: A1SMS9
Position
complement(3830561..3830836)
Genome map
AA seq 91 aa AA seqDB search
MVVHSGRRSDSIGTVTRGRQFFTGLLVALVLTVAISAGLFFGSHAGEAFDDAFWPILGVT
AALGVVCGAGASFLVQVGALMAMFFAGGGGS
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtgcactccggtcgccgatcggacagtatcgggacggtgactcgcgggcgtcag
ttcttcacgggacttctcgttgcgctggtcctgaccgtggcgatctcggcaggtctcttc
ttcgggtcccatgcgggcgaggccttcgacgacgccttctggccgatcctgggggtcacc
gccgcgctcggcgtcgtgtgcggcgcgggcgcgtccttcctcgtccaggtcggcgcgctg
atggccatgttcttcgccggtggcggaggcagttag

DBGET integrated database retrieval system