KEGG   Nocardioides sp. JS614: Noca_3618Help
Entry
Noca_3618         CDS       T00443                                 

Definition
(GenBank) MMPL domain protein
  KO
K06994  putative drug exporter of the RND superfamily
Organism
nca  Nocardioides sp. JS614
Brite
KEGG Orthology (KO) [BR:nca00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Noca_3618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMPL Sterol-sensing Patched KNOX2
Motif
Other DBs
NCBI-ProteinID: ABL83118
UniProt: A1SMT3
Position
3834830..3836968
Genome map
AA seq 712 aa AA seqDB search
MHRQIAGKLTGRVSKWLVLIAVLVIAGIMGSFAGKLTDVQNNETESWLPSSAESTKGFEK
LTAFQDEYDVGTTVVYHREGGLTQADLTAIEGQAAEIEQIKGITDVVTPQRAEAAGIPAP
FVSDDGQVAKLQFTVNYGDKLWEELPDLKDRLDAITAIDGVDTYLAGAGGQSADAATIFS
SFDSKLLLVTLGVVVLILLVSYRSPLLWALPIISAGVGLMTTMGLLYFLAKYAGLTVNGQ
TQFILTVLVIGAGTDYALLLVARYREELRRHEDRHEAMAFALHRAAPAILASAATVVVGL
LCLTFAELNSTAGMGPANAIGIAITFVVMVTLLPALLVICGRWVFWPLVPRYGSQEPTAS
GLWARVGKGIAPRPRTVWVGTAIVLGVLCLGFLRLDTSGIPSDEQYTTQQDSVTGQSILV
DHGLVDASTPVQVVANEDKAEDVAAAMSKVDGIADPVVVAAKDGVALVVAELTSDPYSQA
AYDAVEDVRSATHDVAGADALTTGMTAVSLDIEEAAARDNLVIIPIVLLAVLLILIGLLR
SLVSPLILVGTVILSFGAALGISGLVFDFIYGYENTDTGYPLFSFVFLVALGIDYNIFLM
TRVREETAVQGTRRGSLIALSSTGGVITSAGIVLAATFGMLATMPMTFTLQLGTTIALGV
LLDTMIVRSVLVTAVNLDLGGKIWWPSALDRKPPVEFTPEEPTPEPEALPVG
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgtcagatcgcaggcaagctcaccggccgcgtcagcaagtggctcgtactcatc
gcggtcctcgtgatcgccggcatcatgggctccttcgcgggcaagctcaccgacgtccag
aacaacgagaccgagtcctggctcccgtccagcgccgagtccaccaagggcttcgagaag
ctcaccgccttccaggacgagtacgacgtcggcaccacggtcgtctaccaccgcgagggc
gggctcacccaggccgacctgaccgcgatcgagggacaggccgccgagatcgagcagatc
aagggcatcacggacgtcgtgacgccgcagcgggccgaggcggccggcatccccgcgccg
ttcgtctccgacgacggccaggtcgccaagctgcagttcaccgtcaactacggcgacaag
ctctgggaggagctgcccgacctcaaggaccggctcgacgcgatcaccgcgatcgacggc
gtcgacacctacctcgccggcgccggcgggcagagcgccgacgcggccacgatcttcagc
tccttcgacagcaagctgctgctggtcaccctcggagttgtggtcctgatcctgctggtc
agctaccgcagcccgctgctgtgggcgctcccgatcatcagcgcgggcgtcgggctgatg
acgaccatgggcctgctgtacttcctcgccaagtacgccggcctgaccgtcaacggccag
acccagttcatcctgacggtgctcgtgatcggtgccggcaccgactacgccctcctcctg
gtcgcccgctaccgcgaggagctgcgccgccacgaggaccggcacgaggcgatggcgttc
gcgctgcaccgcgccgcccccgcgatcctggccagcgccgcgaccgtcgtcgtcgggctg
ctctgcctgaccttcgccgagctgaactccacggccggcatgggcccggccaacgcgatc
ggcattgccatcacgttcgtggtgatggtgaccctgctcccggcgctgctggtgatctgc
ggccggtgggtcttctggccgctggtcccgcgctacggctcccaggagcccacggcctcc
ggactctgggcccgcgtcggcaagggcatcgcgccgcgcccgcggaccgtctgggtcggc
acggccatcgtcctcggcgtgctgtgcctgggcttcctccggctcgacacctccggcatc
cccagcgacgagcagtacaccacccagcaggactccgtcaccggccagtcgatcctcgtc
gaccacggcctggtcgacgccagcacgcccgtccaggtggtcgccaacgaggacaaggcc
gaggacgtcgccgcggcgatgtcgaaggtcgacgggatcgccgaccccgtggtcgtcgcc
gccaaggacggcgtggccctggtcgtcgcggagctgaccagcgacccgtactcgcaggcg
gcgtacgacgccgtcgaggacgtgcgatcggcgacccacgacgtggcgggcgcggacgcg
ctgaccaccggcatgacggcggtctcgctcgacatcgaggaggcggcggcgcgcgacaac
ctggtgatcatcccgatcgtcctgctcgccgtgctgctgatcctgatcgggctgctgcgc
tcgctggtctcgccgctgatcctggtcgggacggtgatcctgtccttcggggccgcgctg
ggcatctccgggctggtgttcgacttcatctacggttacgagaacaccgacaccggatat
ccgctgttcagcttcgtgttcctcgtcgccctcggcatcgactacaacatcttcctgatg
acccgggtccgcgaggagacggccgtccagggcacccgcaggggatcgctgatcgcgctg
tcctccacgggcggggtgatcacgtccgccggcatcgtgctggccgcgacgttcgggatg
ctcgcgaccatgccgatgacgttcaccctccagctcggtacgacgatcgcgctcggcgtg
ctgctggacacgatgatcgtccgctcggtgctggtcaccgcggtcaacctcgacctgggc
gggaagatctggtggccgagcgcgctggaccgcaagccgccggtcgagttcacccccgag
gagccgacgcccgagcccgaggcgctgccggtcggctga

DBGET integrated database retrieval system