KEGG   Nocardioides sp. JS614: Noca_3620Help
Entry
Noca_3620         CDS       T00443                                 

Definition
(GenBank) Fructose-6-phosphate phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00030  Pentose phosphate pathway
nca01100  Metabolic pathways
nca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Noca_3620
Enzymes [BR:nca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Noca_3620
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Noca_3620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABL83120
UniProt: A1SMT5
Position
complement(3839565..3841961)
Genome map
AA seq 798 aa AA seqDB search
MDASLDTLDRWWRAANYLSVGQIYLMDNPLLREPLVAEHVKPRLLGHWGTTPGLNFVYAH
LNRAIMARQQQMIFITGPGHGGPGLVASSYLEGTYSEVYTDITQDAAGMQRLFKQFSFPG
GIPSHVAPETPGSIHEGGELGYALSHAYGAAFDNPDLVVAAVVGDGEAETGPLATSWHSN
KFLDPRRDGAVLPILHLNGYKIANPTVLARIPEDELVSLLRGYGYTPYVVAGSDAAQMHA
DFAGTLDRCLEEIAGIQGEARAASDPLPRPAWPMIVLRSPKGWTGPKEVDGKRVEDFWRS
HQVPFANARSDDAHRAVLEEWLRSYRPEELFDESGAPAPDIAALHPGGELRMSASPHANG
GLLLKPLRMPDFRDYAVEVDAPGTGSVEATRVLGGFLRDVMAQNMHNFRMFAPDENSSNR
LQDVMEVTDRAWNAEILGYDDHLAPDGRIMEILSEHTCQGWLEGYLLTGRHGLFSCYEAF
IHLIDSMFNQHAKWLESTRRIEWRRPVASLNYLLTSHVWRQDHNGFSHQDPGFIDHVVNK
KANVVRVYLPPDANTLLSVGDHCLRSKHYVNVVVAGKQPALQYLSMDDAIVHCTKGAGIW
DWASNDGDEGPDVVIACAGDVPTMEALAAVDLLREHLPDLRIRFVNVVDLMRLQPASEHP
HGFSEADFDALFTTDRPVIFAYHGYPWLIHRLTYKRTNHANIHVRGYKEEGTTTTPFDMT
VLNHMDRYNLAIDVIDRVPRLAATSSDAREEFKNALIRHRQYIRTYGEDLPEIRDWTWQG
SFGPRYRTATPELDAPEG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaagcctggacaccctcgatcgctggtggcgcgccgccaactacctgtccgtc
ggccagatctacctgatggacaacccgctgctgcgcgagcccctggtcgccgagcacgtc
aagccgcgcctgctgggccactggggcaccacgcccgggctgaacttcgtgtacgcgcac
ctcaaccgggcgatcatggcccgtcagcagcagatgatcttcatcaccggtcccggccac
ggtggtccgggcctggtcgcgtcgtcctacctcgaggggacctactccgaggtctacacc
gacatcacccaggatgcggccgggatgcagcggctgttcaagcagttctcgttcccgggt
ggcatccccagccacgtggccccggagacaccgggctcgatccacgagggcggcgagctc
ggctacgcgctctcgcacgcgtacggcgccgcgttcgacaaccccgacctcgtggtggcc
gccgtcgtcggggacggcgaggccgagaccggcccgctcgcgaccagctggcactccaac
aagttcctggacccgcgtcgtgacggcgcggtgctgccgatcctgcacctcaatggctac
aagatcgccaacccgaccgtgctggcccggatccccgaggacgagctggtctcgctgctg
cgtggctacgggtacacgccgtacgtcgtggcgggctcggacgccgcccagatgcacgcc
gacttcgccggcaccctggaccggtgcctcgaggagatcgcggggatccagggcgaggcg
cgcgccgcctcggacccgctgccgaggccggcctggccgatgatcgtgctgcgctccccg
aagggatggaccggcccgaaggaggtcgacggcaagcgcgtcgaggacttctggcgctcc
caccaggtcccgttcgccaacgcccgcagcgacgacgcgcaccgtgcggtgctcgaggag
tggctgcgcagctaccgacccgaggagctcttcgacgagtcgggggcgcccgccccggac
atcgccgccctgcacccgggcggtgagctgcggatgagcgcgtcgccgcacgccaacggc
ggcctgctgctcaagcccctgcggatgcccgacttccgtgactacgcggtcgaggtggac
gcaccaggtacgggctcggtcgaggcgacccgggtgctgggcgggttcctgcgcgacgtg
atggcgcagaacatgcacaacttccggatgttcgcccccgacgagaactcctccaaccgg
ctccaggacgtcatggaggtgaccgaccgggcgtggaacgccgagatcctcggctacgac
gaccacctcgcgccggacggccggatcatggagatcctctccgagcacacctgccagggc
tggctcgagggctacctgctcaccgggcgccacgggctcttctcctgctacgaggcgttc
atccacctgatcgactcgatgttcaaccagcacgcgaagtggctggagtccacccggcgc
atcgagtggcggcggccggtggcgtcgctgaactacctgctcacctcgcacgtgtggcgc
caggaccacaacgggttctcgcaccaggacccgggcttcatcgaccacgtcgtgaacaag
aaggccaacgtggtgcgggtctacctgccgccggatgccaacacgctgctctcggtgggc
gaccactgcctgcgcagcaagcactacgtcaacgtcgtggtcgcggggaagcagccggcg
ctgcagtacctctccatggacgacgcgatcgtgcattgcaccaagggcgccggcatctgg
gactgggcgtcgaacgacggcgacgagggtcccgacgtggtcatcgcctgtgccggcgac
gtgccgacgatggaggcgctggccgcggtcgacctgctgcgcgagcacctgcccgacctg
cggatccggttcgtcaacgtggtggacctgatgcgcctccagcccgcgagcgagcacccg
cacgggttctcggaggccgacttcgacgccctgttcaccaccgaccggccggtgatcttc
gcctaccacggctatccgtggctgatccaccggctgacctacaagcgcaccaaccacgcc
aacatccacgtgcgcgggtacaaggaggagggcaccaccaccacgccgttcgacatgacg
gtcctcaaccacatggaccgctacaacctcgccatcgacgtgatcgaccgggtgccgcgg
ctggcggcgacctcgagtgacgcgcgggaggagttcaagaacgccctgatccggcaccgg
cagtacatccgcacctacggcgaggacctgccggagatccgcgactggacctggcagggc
tccttcgggccccgctaccgcaccgcgacccccgagctcgacgccccggagggctga

DBGET integrated database retrieval system