KEGG   Nocardioides sp. JS614: Noca_3622Help
Entry
Noca_3622         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4064 DUF1206
Motif
Other DBs
NCBI-ProteinID: ABL83122
UniProt: A1SMT7
Position
3842546..3842689
Genome map
AA seq 47 aa AA seqDB search
MAFLLWILAVILVIAGIFQLFKGQLLWGIVLIIVGLLVGPGGVSIFT
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
atggcattcctgctgtggatcctggccgtcatcctcgtgatcgccggcattttccagctc
ttcaagggccagctgctctggggcatcgtgctgatcatcgtgggcctgctcgtcgggccc
ggcggcgtcagcatcttcacctag

DBGET integrated database retrieval system