KEGG   Nocardioides sp. JS614: Noca_3625Help
Entry
Noca_3625         CDS       T00443                                 

Definition
(GenBank) luciferase-like protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase DUF3254
Motif
Other DBs
NCBI-ProteinID: ABL83125
UniProt: A1SMU0
Position
3844184..3844792
Genome map
AA seq 202 aa AA seqDB search
MPAIRSPYQVAKSVGTAAVLSGNRVSLGVGIGWCREEFELLGQDFTTRGRRTDEALALLA
ALWTPGWTEFEGESYTAPRLTMEPTPTERIPILVGGLSEVAFRRAARHDGWVGDIYPVDE
AIALAGRLAEVRREAGADDDFTVVAALSDAFLPEHFARAAAGGITDCWTMPWAYYHGPDA
TLEQKVDALERFAREVVVPVNG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgccggccatccggagcccgtaccaggtcgccaagagtgtcgggaccgccgcggtgctc
tccggcaaccgggtcagcctcggcgtcgggatcggctggtgccgcgaggagttcgagctg
ctcggccaggacttcaccacccggggccggcgtaccgatgaggcgctcgcgctgctggcc
gcgctgtggacgccgggctggaccgagttcgaaggcgagtcctacaccgcgccgcggctg
accatggagccgacgccgaccgagcggatcccgatcctggtcgggggcctgtccgaggtc
gcgttccggcgcgcggcccgccacgacggctgggtcggtgacatctacccggtcgacgag
gcgatcgccctggccgggcggctcgcagaggtccgccgggaggccggtgcggacgacgac
ttcaccgtggtcgccgcgctcagtgacgcgttcctgcccgagcacttcgcccgggcggcg
gccggcgggatcacggactgctggacgatgccgtgggcctactaccacggaccggacgcg
accctggagcagaaggtcgacgccctggagcggttcgcacgcgaggtggtcgtccccgtc
aacggctga

DBGET integrated database retrieval system