KEGG   Nocardioides sp. JS614: Noca_3630Help
Entry
Noca_3630         CDS       T00443                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00270  Cysteine and methionine metabolism
nca01100  Metabolic pathways
nca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Noca_3630
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Noca_3630
Enzymes [BR:nca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Noca_3630
    2.3.1.46  homoserine O-succinyltransferase
     Noca_3630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ABL83130
UniProt: A1SMU5
Position
3848010..3849119
Genome map
AA seq 369 aa AA seqDB search
MTGSLGYVETQRVVLAGPDDPLHLRGGGRLDHVEVAYETYGSLSPARDNAVFICHALTGD
AHAAGLHVGSKKRGWWDNLIGPGKPVDTDRFFVISANLLGGCSGSTGPLSTDPATGAPYC
LDFPMLHMSDLVAAHRRLVAHLGIERLHAAVGGSLGGMQVLQWVIDEPDALERAVLVAAS
SRLSPENIAFSAIGREAIMSDPDFCNGRYVEQGVFPWRGQKVARMMAHITYVSAQSLETK
FGHRRRSRGDAWTLGPDYEVEHYLQHQGQVFLGRFDALSYLYLTRLLDYFDPFADPGTAA
ALRSTATRFQLTSFDSDWRFDSTQSARMTAELKALGVAVDWAELASPFGHDSFLLQPPGY
HERIAEFLG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccggctcgctcggctacgtcgagacgcagcgggtcgtcctggccggcccggacgac
ccgctgcacctgcgaggcggcggccgcctcgatcacgtcgaggtcgcctacgagacctac
gggtcgctctcgccggcacgcgacaacgccgtcttcatctgccacgccctcaccggcgac
gcccacgccgccgggctgcacgtgggctcgaagaagcgcgggtggtgggacaacctgatc
ggcccgggcaagcccgtggacaccgaccgcttcttcgtcatctccgccaacctgctgggc
ggctgctcgggcagcaccggcccgctgtcgaccgacccggccaccggcgcgccgtactgc
ctcgacttcccgatgctgcacatgagcgacctggtcgccgcacaccggcgactggtcgcg
cacctcgggatcgagcggctgcacgccgcagtcggcggatcgctcggcggcatgcaggtc
ctgcaatgggtgatcgacgaacccgacgcgctcgaacgagcggtcctcgtggccgcgtcc
tcccggctgtcaccggagaacatcgcgttctccgcgatcggccgcgaggcgatcatgtcc
gaccccgacttctgcaacggacggtacgtcgagcagggcgtcttcccctggcgcggccag
aaggtcgcccggatgatggcgcacatcacctacgtctcggcccagtccctcgagacgaag
ttcggccaccgccgcaggtctcgcggcgacgcctggacgctcggcccggactacgaggtg
gagcactacctgcagcaccagggacaggtgttcctgggccggttcgacgccctgtcctac
ctctacctgacccgcctgctcgactacttcgacccgttcgccgacccggggacggccgct
gcgctgcgcagcaccgcgacccggttccagctgacctcgttcgactccgactggcgcttc
gactccacccagtccgcgcggatgaccgcggagctgaaggccttgggggtggcggtggac
tgggccgagctggcctcaccgttcggccacgactcgttcctcctgcagcctccggggtac
cacgagcggatcgccgagttcctcggctga

DBGET integrated database retrieval system