KEGG   Nocardioides sp. JS614: Noca_3636Help
Entry
Noca_3636         CDS       T00443                                 

Definition
(GenBank) aminoglycoside phosphotransferase
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH
Motif
Other DBs
NCBI-ProteinID: ABL83136
UniProt: A1SMV1
Position
complement(3857114..3858241)
Genome map
AA seq 375 aa AA seqDB search
MTQAPPPADLRMQRSSREASTVPARLAGWLAPVLPDGADPVVTLHSGVDANGMSSETLIL
DVAWTEGGERRLGEYVARVAPALDDLPVFPTYALQDQYDAIRIVGETTDVPVPQVRWMEP
TGEVLGTPFFLMDRIDGLVPQDVLPYNFGDNWLHDATHADQRRLQDATVDVIARLHAIPD
AATRFGFLDPAHPGETPLARNLARTRAWYEFAVADIGRSPLVERGLAWLEAHLPDTDEAV
LCWGDSRIGNVLYRDFEPVGVLDWEMAALGPRELDLSWVVFAHQVFETITGMLELPGMPH
FLREEDVRATYAERTGVQVGDLHWYHVYNAVQWCIVFMRTGARQIHFGEIERPDDLETLF
HHKPLMERLLEEAGA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaggcgccgccgccggccgacctgaggatgcagcgctcgagcagggaggcgagc
accgtgccggcccggctggccgggtggctggcgccggtgctgcccgacggggccgacccg
gtggtgacgctgcacagcggcgtggacgccaacgggatgtcctcggagacgctgatcctc
gacgtcgcctggaccgaggggggtgagcgccggctgggggagtacgtcgcccgcgtggca
cccgcgctcgacgacctcccggtcttcccgacctacgcgctccaggaccagtacgacgcg
atccgcatcgtcggcgagaccaccgacgtcccggtgccacaggtgcgctggatggagccg
accggcgaggtgctcggcaccccgttcttcctcatggaccgcatcgacgggctggtgccg
caggacgtgctgccctacaacttcggcgacaactggctccacgacgccacccacgcggac
cagcgccggctccaggacgccacggtcgacgtgatcgcccggctgcacgcgatccccgac
gccgccacgaggttcgggttcctcgacccggcacaccccggcgagaccccgctggcccgc
aacctcgcgcggacccgcgcctggtacgagttcgcggtcgccgacatcggccgctccccg
ctggtcgagcgcggcctggcgtggctcgaggcgcacctgcccgacaccgacgaggccgtg
ctgtgctggggcgactcccgcatcggcaacgtgctctaccgcgacttcgagccggtcggc
gtcctcgactgggagatggccgcgctcggcccgcgcgagctcgacctgtcgtgggtggtc
ttcgcccaccaggtcttcgagacgatcaccgggatgctcgagcttcccggcatgccgcac
ttcctgcgcgaggaggacgtcagggcgacgtacgccgagcgcaccggcgtccaggtcggc
gacctgcactggtatcacgtctacaacgcggtgcagtggtgcatcgtgttcatgcgcacc
ggcgcccggcagatccacttcggcgagatcgagcgcccggacgacctcgagacgctgttc
caccacaagccgctgatggagcgcctcctcgaggaagcaggagcatga

DBGET integrated database retrieval system