KEGG   Nocardioides sp. JS614: Noca_3647Help
Entry
Noca_3647         CDS       T00443                                 

Definition
(GenBank) chaperonin Cpn10
  KO
K04078  chaperonin GroES
Organism
nca  Nocardioides sp. JS614
Brite
KEGG Orthology (KO) [BR:nca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nca03110]
    Noca_3647
   03029 Mitochondrial biogenesis [BR:nca03029]
    Noca_3647
Chaperones and folding catalysts [BR:nca03110]
 Heat shock proteins
  HSP10
   Noca_3647
Mitochondrial biogenesis [BR:nca03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    Noca_3647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn10
Motif
Other DBs
NCBI-ProteinID: ABL83147
UniProt: A1SMW2
Position
complement(3872299..3872592)
Genome map
AA seq 97 aa AA seqDB search
MSVNIKPLEDRIVVKPLDAEQTTASGLVIPDTAKEKPQEGEVLAIGPGRIDDNGNRVPLD
VTVGDKVIYSKYGGTEVKYAGEEYLILSARDVLAVVS
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtcaacatcaagcccctcgaggaccggatcgtcgtcaagccgctcgacgccgag
cagaccacggcctcgggcctggtcatcccggacaccgccaaggagaagccccaggagggc
gaggtcctcgcgatcggcccgggtcgcatcgacgacaacggcaaccgcgtcccgctcgac
gtcaccgtcggcgacaaggtcatctacagcaagtacggcggcaccgaggtcaagtacgcc
ggcgaggagtacctcatcctctccgcgcgcgacgtcctggctgtcgtttcctga

DBGET integrated database retrieval system