KEGG   Nocardioides sp. JS614: Noca_3650Help
Entry
Noca_3650         CDS       T00443                                 

Definition
(GenBank) beta-lactamase domain protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2 ATXN-1_C
Motif
Other DBs
NCBI-ProteinID: ABL83150
UniProt: A1SMW5
Position
complement(3874935..3875558)
Genome map
AA seq 207 aa AA seqDB search
MAGPGPARVDHAVSSGTFSLDGETFEVENNIWVVGDDAECVVIDAPHDVADILAVVGDRK
VKAIVCTHAHDDHVRVAPALREEVVAPIMLHPADRPLWELTHTRYLWDLDLEDGLEIEVG
GTSLRVLHTPGHAPGAVCLYASDLGCVFTGDTLFQGGPGATGRSFSDADLIVESIRTTLF
ALPDDTVVHTGHGADTTIGAERVGLGS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggccgggccgggcccggcgcgggtcgaccacgcggtgtcctccggaacgttcagcctc
gacggggagacgttcgaggtcgagaacaacatctgggtcgtgggcgacgacgccgagtgc
gtcgtgatcgacgcgccgcacgacgtcgccgacatcctggccgtcgtgggggaccggaag
gtgaaggcgatcgtgtgcacgcacgcgcatgacgaccacgtccgggtcgctccggcgctg
cgggaggaggtcgtggcgccgatcatgctgcacccggccgaccgcccgctgtgggagctc
acgcacacccgctacctctgggacctcgacctcgaggacggcctggagatcgaggtcggt
ggcaccagcctgcgggtgctgcacacccccgggcacgcgccgggcgcggtctgcctgtac
gcctcggacctgggctgcgtcttcaccggggacaccctgttccagggtggtcccggggcc
actggacggtcgttctccgacgccgacctgatcgtggagtcgatccggacgacgctgttc
gcgctgcccgacgacacggtcgtccacaccggtcacggcgcggacaccacgatcggcgcc
gaacgggtgggactcgggtcctga

DBGET integrated database retrieval system