KEGG   Nocardioides sp. JS614: Noca_3654Help
Entry
Noca_3654         CDS       T00443                                 

Definition
(GenBank) Sigma-70, region 4 type 2
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r4 Sigma70_r2 HTH_23 Sigma70_ECF GerE
Motif
Other DBs
NCBI-ProteinID: ABL83154
UniProt: A1SMW9
Position
3878992..3879510
Genome map
AA seq 172 aa AA seqDB search
MTERDADFTAYLQARLGRLLRIAYLLTGDQHQAEDLLQTSLAKLYLSWDRVRDRGSVDAY
VRRIMVNENNSLWRRGWKRREAPTDVVPEGSPVHDAYDEGLGAAVWAVVQTLPRKARAVV
VLRYYEQLSEAETADVLGISVGTVKSQTSRALAALRERTPADLSPTHREEER
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcgggacgccgacttcacggcgtacctccaggcccgcctggggcgcctgctc
cggatcgcgtacctgctcaccggggaccagcaccaggccgaggacctgctgcagacctcg
ctggccaagctctacctgtcgtgggacagggtccgcgaccgcggctcggtggacgcctac
gtccgccggatcatggtcaacgagaacaactcgctgtggcgtcgcggctggaagcggcgc
gaggcgccgaccgacgtggtgcccgagggcagtcccgtccacgacgcgtacgacgagggt
ctcggcgcggcggtgtgggcggtcgtccagacgctgccccgcaaggcccgggccgtggtc
gtgctgcgctactacgagcagctgtccgaggccgagaccgccgacgtgctcggcatctcc
gtcggcaccgtgaagtcacagaccagccgggcgctcgccgcgctgcgcgagcgaacgccc
gccgacctgagcccgacgcaccgggaggaggagcgatga

DBGET integrated database retrieval system