KEGG   Nocardioides sp. JS614: Noca_3658Help
Entry
Noca_3658         CDS       T00443                                 

Definition
(GenBank) transcriptional regulator, AsnC family
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_24 HTH_AsnC-type AsnC_trans_reg HTH_20 HTH_Crp_2 MarR_2 Crp HTH_IclR HTH_CodY MarR HHH DGOK
Motif
Other DBs
NCBI-ProteinID: ABL83158
UniProt: A1SMX3
Position
complement(3884110..3884559)
Genome map
AA seq 149 aa AA seqDB search
MDRTDRAIIEHLRRDAHLTNTELADLVGLTPSPCLRRVRRLEAEGVILGYHARINPAAVG
RAFEVHVEFELANQAKATVKDFESGLIAFDEVIEARRMFGQPDYLALVAVADLHAYEVFM
TEELMALPGMGRLQSRFAMKTIKSELAST
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtacagatcgcgcaatcatcgagcacctgcgtcgggacgctcacctcacaaac
acggaacttgccgacctagtaggacttacgccgtccccgtgtctgcgccgggtccgccgc
ctggaggccgaaggggtcatcctcggctaccacgccaggatcaacccggctgcggtcggc
cgagcgttcgaggtccatgtcgagttcgaactggccaaccaggccaaggccacggtcaag
gacttcgagtccggcctgatcgccttcgacgaagtaatcgaggcacgccgcatgttcggg
cagcccgactacctcgcgctggtggcggtagccgacctgcatgcctacgaggtcttcatg
actgaagagttgatggcgctgccggggatgggacgcctccaatcgcgcttcgccatgaag
accatcaagagcgagctggcctccacttga

DBGET integrated database retrieval system