KEGG   Nocardioides sp. JS614: Noca_3660Help
Entry
Noca_3660         CDS       T00443                                 

Definition
(GenBank) death-on-curing family protein
  KO
K07341  death on curing protein
Organism
nca  Nocardioides sp. JS614
Brite
KEGG Orthology (KO) [BR:nca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:nca02048]
    Noca_3660
Prokaryotic defense system [BR:nca02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Doc-Phd
    Noca_3660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fic
Motif
Other DBs
NCBI-ProteinID: ABL83160
UniProt: A1SMX5
Position
complement(3885357..3885719)
Genome map
AA seq 120 aa AA seqDB search
MTVLLTVEDLLSLVADLGVGPVRDVGLLDSAAHRPGAVLYGHEAYQDVDRKAAALLDSLV
GNHALVDGNKRLGWLAVVVFYGLNGVDLGAPDDPAFELVMSVARREAPLDEIAATLVRWH
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
ttgacggttctgctcacggtcgaggatctcctgtccctcgtggcggacctcggggtcgga
ccggtgcgcgacgtgggtctgctggactcggcagctcatcggccgggggctgtcctgtac
ggacacgaggcctaccaggacgtggaccgcaaggcagcagcgctgctcgactcactcgtt
ggcaaccatgcgctcgtcgatggaaacaagcgactgggttggctggccgttgtcgtcttc
tacggcctcaacggcgtcgacctcggtgcgcccgatgatcctgcctttgagctcgtgatg
tccgtggcgcgcagagaagcgcctctcgacgaaatcgcagcaactctggtgcgctggcat
tga

DBGET integrated database retrieval system