KEGG   Nocardioides sp. JS614: Noca_3680Help
Entry
Noca_3680         CDS       T00443                                 

Definition
(GenBank) carbohydrate ABC transporter ATP-binding protein, CUT1 family
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 TOBE_2 OB_MalK Rad17 RsgA_GTPase AAA_22 AAA_16 AAA_23 AAA AAA_25 AAA_30 TOBE AAA_33 AAA_15 AAA_28 CysA_C_terminal Zeta_toxin AAA_29 NACHT HSM3_N
Motif
Other DBs
NCBI-ProteinID: ABL83180
UniProt: A1SMZ5
Position
complement(3902770..3903864)
Genome map
AA seq 364 aa AA seqDB search
MAAVELRHVSKIFGSKTTVDDISLTLPDGQLTVLVGPSGCGKTTTLRMIAGLEAVSHGSI
HFDGEDVTGGEPRTRDVSMVFQNYALYPHLTVQDNLAFPVLARGGKRADAIRRAREAAEM
LGLTELLQRKPGQLSGGQQQRVAIGRAVVREPRVFLFDEPLSNLDARLRVEMRSEILRLQ
RQLGVTAVYVTHDQEEAMTMSDSMVVMDGGTIAQQGSPREVYAAPATTFVAGFVGSPRMN
LIAGRVVGGVFESRWGRVPMGAADQEGSLGVRPELVRLVGADHNESSRARNDPGAGAGAA
ARVELVELLGPRAIVSLNADGERLIAVVEARDLSGIHEGSLVDVDFASAGLHFFEAGGQR
LLTT
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgtcgagttgcgtcacgtctccaagatcttcggttccaagacgactgtcgat
gacatcagtctcaccctgcccgacggacagctcaccgtgttggtcgggccatccgggtgc
ggaaagacgaccacgctccgcatgatcgctggcttggaagccgtttcccacggctcgatc
cacttcgacggagaggacgtcaccggtggagaaccgcggactcgcgatgtgtcgatggtg
ttccagaactacgccctctacccccatctgacggttcaggacaatcttgcctttccggtt
cttgctcgcggcggcaagcgcgccgatgccattcgacgagcacgtgaggcggctgagatg
ctcgggctcaccgaactgctgcagcgcaagcctgggcaactctcggggggacagcagcag
cgggtggcaatcggacgtgccgtcgtgcgagaaccgcgggtgttcctgttcgacgagccg
ctgtccaacctggatgcgcggttgcgggtggagatgcgctcggagatcctccggctgcag
cgtcagcttggtgtcacggccgtctatgtcacccacgaccaggaggaggcgatgaccatg
tccgacagcatggtcgtcatggacggcggcaccatcgctcagcagggcagcccgcgggag
gtctacgccgctccagccaccactttcgtcgccggattcgtcggatcgccccgcatgaac
ctgatcgccggtcgggtcgtcggtggggtcttcgagtctcggtggggtcgagtgccgatg
ggtgccgccgaccaggaaggcagcttgggtgtacgccccgagctcgttcgtctggtcggg
gctgaccacaacgagtcgagccgggcaaggaatgatcctggcgccggtgcgggcgctgcg
gcccgagtcgagctggtcgagcttctaggtccgcgagccatcgtctcgctcaacgccgat
ggcgagcggctcattgcagtcgtggaggctcgcgacctgtcgggcatccatgagggcagc
ctggtcgacgtggacttcgcgtctgcgggcctgcacttcttcgaagccggcggacagcgg
ctgttgacgacgtga

DBGET integrated database retrieval system