KEGG   Nocardioides sp. JS614: Noca_3681Help
Entry
Noca_3681         CDS       T00443                                 

Definition
(GenBank) carbohydrate ABC transporter membrane protein 2, CUT1 family
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF5467
Motif
Other DBs
NCBI-ProteinID: ABL83181
UniProt: A1SMZ6
Position
complement(3903878..3904795)
Genome map
AA seq 305 aa AA seqDB search
MSDSTSSRRFATRFAPSADRNASRGPRRSQDGSLRPVSGAWATGGRLLLGGAFLLVALPL
FWVVLGSFKSPTALNDPTAVVFSPTTSNWSAIASSGVLGSAGRSALVGLATVIISLVLGS
MAAYSISRFKTGGDVTRFGILAAQVLPPAVLVFPFLVVSYNLRLNDTLVAVTSAHLSFVL
PVVCWFLIGFFDAVPISIEEQAMVDGLTRFAAFRKVVLPQVAPGMGAAAIFGFVLSWNDL
FYALILAPGNSATLPVTIASFNTFRGVELGAMCAAIVVSIVPVLIVSYVVQRRLVQGLAG
GAVKF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactcgacgtcgtcccgccgcttcgcgacccggttcgcgcccagtgccgatcgc
aacgcctcgcgcggcccacggcggtcgcaggacggctccctccgccccgtcagcggggcg
tgggccacgggcggacggcttctcctcggaggtgccttcctcctggtcgcgttgccgttg
ttctgggtggtgctcggcagcttcaagagccccacagcgctcaacgatccgaccgccgtg
gtgttcagcccgacgacatcgaactggtcagcgatcgcctcatctggggttctcggctcc
gctggtcgcagcgcacttgtcggcctcgcgacggtgatcatctcgctcgtgctcggctcg
atggccgcgtactcgatctcgcgcttcaagacgggcggcgacgtgacgcgattcgggatc
cttgccgcgcaagtcctcccgcccgcggtgctcgtcttcccgttcctggtcgtctcctac
aacttgcgcctcaacgacacgctcgtggctgtgacgtcggcccatctcagcttcgtcctg
ccggtcgtgtgctggttcctgatcgggttcttcgacgcggttcccatctcgatcgaggag
caggccatggtggacgggctgactcgcttcgccgccttccggaaggtggtactccctcag
gtcgctcccggcatgggtgcggctgccatcttcggattcgtcctgtcgtggaacgacctc
ttctacgctttgatcctcgcgcccggcaactcggcgactctgcccgtcacgattgccagc
ttcaacaccttccgtggtgtcgagttgggcgctatgtgcgccgccatcgtcgtctcgatc
gtgccggtcctcatcgtcagctacgtcgtccagcgccgcctcgtccagggcctcgctggc
ggcgcggtcaagttctag

DBGET integrated database retrieval system