KEGG   Nocardioides sp. JS614: Noca_3685Help
Entry
Noca_3685         CDS       T00443                                 

Definition
(GenBank) carbohydrate kinase, FGGY
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C
Motif
Other DBs
NCBI-ProteinID: ABL83185
UniProt: A1SN00
Position
complement(3907845..3909377)
Genome map
AA seq 510 aa AA seqDB search
MPRTEGRSLSIGDEVTVGVDIGSSGVKVLAHSRVRGVLATASVPVELYSPEPGWAEADPE
EWWEATCRATRQVVHDLPEGLPVSVVAVSGMVPAVVCVDARGGSLGPAMLQNDARATREI
AELARELAGIDLLERTGSVLSQQSVAPSVRWLQRHEPDRWAKTRWVVGSYDYVAMRMGAS
PHVELNWAIESGLYDLAGEPVAAVWDAVRLDADRVPALHRPGDAVGTLSASAAADLGLRG
GTTIVVGGADHVMSAYAAGLAEEGDVLVKLGGAGDILAVANGPVLDSRLYLDAHPIPNRW
LPNGCMATSGSMLRWLQTIHGRQDLEQLDQEATGRPAAALVALPYLLGEKTPHHDPWLRG
AFLGVHLGTTAADLHRAALEAIAYGFRQHVEVLREAGVAVTTVRVTNGGSRSVLWKQVLA
DVLNMPLIPVRDHPGASLGAALAGSVQGPDDWVRAAAGIQYDTPIEPDGDRTRRYADAYQ
IFLDLQEQVNPLARRLARLGADEDTTERTG
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggaccgaaggccgctcactctctattggcgacgaagtgaccgtcggcgtcgac
atcggctcgagtggcgtgaaggtcctcgcgcactctcgcgtgcgcggggttcttgccacc
gcctcggtgccggttgagctctactcgccggagcccgggtgggccgaggccgaccccgag
gagtggtgggaagccacctgccgcgcgactcggcaggttgtgcacgacctgcccgagggc
cttccggtgagcgtcgtcgcggtttccggcatggtcccggccgtggtgtgcgtcgacgca
cgaggaggctccctcggccctgccatgctgcagaacgatgcgcgcgcgacccgcgagatc
gccgagcttgctcgcgagctggccggtatcgacctgctcgagcgcaccggctcggtactc
agccagcaatcggttgcaccctctgtgcggtggctgcaacgtcacgaacctgatcgttgg
gcgaagacccggtgggtggtcggctcctacgactacgtcgccatgcggatgggcgcatca
ccacatgtggagttgaactgggcgatcgaaagtggcttgtacgaccttgccggggagcct
gttgccgcggtgtgggacgcggtgcgtctggatgccgaccgcgttccagcgctccatcgg
ccgggcgacgcggtcggcaccctctcggccagcgccgcagcggacctgggtctgcgggga
ggaaccaccatcgtcgtcggcggggccgatcacgtgatgtcggcctatgccgcggggctt
gccgaggaaggagatgtgctggtcaagctcggtggcgccggtgacatcctcgcggtcgcc
aacggcccggtgctcgactctcgtctctacctcgacgcccatcccatccccaaccgatgg
ctgcccaatggttgcatggccaccagcgggtcgatgctgcggtggttgcagaccatccac
ggcaggcaggacctagaacagctcgaccaagaggcgacgggtaggccggctgccgcgctc
gtggcgctgccctatctcctcggagagaagacgccgcaccacgatccgtggctgcgtggc
gcgttcctgggcgtccacctggggacgaccgccgcggacttgcatcgggcggccctggag
gccatcgcgtacggattccgccagcacgtcgaggtcctccgggaggcgggggtggcagtg
accacggtgcgggtcaccaatggcgggtcgcggtccgtgttgtggaagcaggtcctggcc
gacgttctcaacatgccgctgatccccgtgcgtgaccatccgggggcttcgctcggtgcc
gcgctcgccggatccgtacaaggccctgacgactgggtgcgggcagccgccggcatccag
tacgacacgccgattgagcccgacggtgatcggactcgaagatacgccgacgcgtatcag
atcttcttggacctgcaggagcaggtgaatccgctcgccagacggcttgctcgcctgggc
gccgacgaggacacaacggagaggaccggatga

DBGET integrated database retrieval system