KEGG   Nocardioides sp. JS614: Noca_3686Help
Entry
Noca_3686         CDS       T00443                                 

Definition
(GenBank) photosystem I assembly BtpA
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BtpA
Motif
Other DBs
NCBI-ProteinID: ABL83186
UniProt: A1SN01
Position
complement(3909391..3910209)
Genome map
AA seq 272 aa AA seqDB search
MQWLKETFGVDRPIIAMLHLKPLPGDPHYDATTGMAAVLRAAGEDLRALQDGGVDAVMFS
NEFSLPYLTKTEPITAISMARIIGELASDIRVPFGVNVLWDGPASIDLAAATGAQFVREI
FSGVYASDFGLWNTNVGLSARRQRQHDAMGVRLLFNIVPEAAQYLAHRDLASIARTTVFN
CAPDGLCVSGATAGAATDTDQLRVVKQAAGDTPVFVNTGVRVATLETQLSAADGAIVGTA
FKYDGIFENQVDVSRVTEFMVEARRVRDLVDA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggttgaaggagaccttcggcgtcgacaggccgatcatcgccatgctccacctc
aagccgctgccgggggacccgcactatgacgcgaccaccggcatggcggccgtgctccgt
gcggcaggggaggatctgcgtgcgctccaggacggtggtgtggacgcggtgatgttctcc
aacgagttctcgctcccctatctgaccaagaccgagcccatcaccgcgatctcgatggca
cgcatcatcggtgagctcgccagcgacattcgtgtcccgttcggcgtgaacgtgctctgg
gacggcccggccagcatcgatctggctgctgcgacgggtgcacagttcgtgcgcgagatc
ttctcgggcgtctacgcctcggacttcggactttggaacaccaacgtcgggctgtcggcc
cggcgtcaacgccagcacgacgccatgggagtgcgactgctgttcaacatcgtcccggaa
gcagcgcagtacctggcacaccgagacctggcgagtatcgctcgcacgaccgtcttcaac
tgcgcgcctgacggattgtgtgtctccggagccaccgcgggtgcggcgacagacaccgat
caacttcgggtggtgaagcaggctgctggtgacacgccggtgttcgtcaacactggcgtg
cgggtcgccaccctcgagacacagttgagcgccgcagacggtgcgatcgtcgggaccgcc
ttcaagtacgacgggatcttcgagaaccaggtcgacgtcagccgggtgaccgagttcatg
gtcgaggcacggcgcgtccgcgacctggttgacgcctga

DBGET integrated database retrieval system