KEGG   Nocardioides sp. JS614: Noca_3687Help
Entry
Noca_3687         CDS       T00443                                 

Definition
(GenBank) transcriptional regulator, DeoR family
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoRC HTH_DeoR GntR HTH_11
Motif
Other DBs
NCBI-ProteinID: ABL83187
UniProt: A1SN02
Position
3910350..3911129
Genome map
AA seq 259 aa AA seqDB search
MGAVDERRQAIKDRLRAGDDVRLASLAEDFEVSEMTIRRDFEALEEEGVLRRVLGGAIPV
GGIGKSREPSFASRVGARATNKAHIGAAVARRFVKGEAVYFDGGSTALAVARAVRHRELE
LTVVTTSLPVAVELVDEPSTSVILLGGQLRQGELTTIGTETTEAIAHYNVDTYVMGVAGV
DPERGLTEYHRDEAGEKRAALRRTDRVIVAVDASKLGKVLLAHVADLAEIHTLVTDAHPD
DPTLAAIRRHGVEIVIAEN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcagtggatgagcggcgtcaggcgatcaaggaccggctccgcgcaggcgacgac
gtgcgactcgccagcctggccgaggacttcgaggtgtccgagatgacgatccgtcgtgac
ttcgaggccctcgaggaggagggggtcctacgacgagtgctgggcggggcgatcccggtc
ggcggcatcggcaagagcagggagccatcctttgcctcgcgggtcggtgcccgggccacg
aacaaggcccacatcggcgcggccgtggcccgtcgattcgtcaagggcgaggccgtctac
ttcgacggcgggagcacggcgctcgccgtggcgcgagcagtcaggcaccgcgagctcgag
ctcacggtcgtcaccaccagccttccggtcgccgttgagctggtcgatgagccgagcacc
agtgtgatcctgctcggcggacaactacgccaaggcgaactgaccacgatcggcaccgag
acgaccgaggcgatcgcgcactacaacgtcgacacctacgtgatgggggtcgccggcgtc
gacccggagcgcggactgacggagtaccaccgagacgaggccggcgagaagcgagccgcc
ctgcgccgtacggatcgcgtcatcgtggccgtggatgcgagcaagctcggcaaggtcctc
ctggcccatgtcgcggacctcgctgagatccacacactcgtgacggacgcccatccggac
gatccgacgctcgccgccatacgaaggcatggagtggagatcgtcatcgccgagaactag

DBGET integrated database retrieval system