KEGG   Nocardioides sp. JS614: Noca_3690Help
Entry
Noca_3690         CDS       T00443                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PemK_toxin
Motif
Other DBs
NCBI-ProteinID: ABL83190
UniProt: A1SN05
Position
complement(3913651..3914028)
Genome map
AA seq 125 aa AA seqDB search
MSYAPRADGRPDPGEVVWGWVPYEDDPRQGKDRPVLLVGRRAGRLLGLMLTSKDHDRDAA
DEARWGRHWMDVGTGGWDRERRPSEVRLDRLIELAPDAVRREGAALDRATFDRVVTAARR
FHSLG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtacgcgccgcgagccgacggccggcccgaccccggcgaggtcgtgtggggctgg
gtgccctacgaggacgacccccgccagggcaaggaccgcccggtgctgctggtcggccgg
cgtgcggggcggctgctcgggctgatgctgaccagcaaggaccacgaccgggacgcggcc
gacgaggcccgttggggccgacactggatggacgtcggcaccggcgggtgggatcgcgag
cggcgtcccagcgaggtgcgtctggaccggctgatcgagctcgcgcccgacgccgtacgc
cgcgagggcgccgccctggaccgggccaccttcgaccgggtggtcacggcggctcgtcgc
ttccactccttgggctga

DBGET integrated database retrieval system