KEGG   Nocardioides sp. JS614: Noca_3694Help
Entry
Noca_3694         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABL83194
UniProt: A1SN09
Position
3920320..3921564
Genome map
AA seq 414 aa AA seqDB search
MRRALALLLAVPLLGLATAGAPPAVGGETFYQVVRELDGRFDAAGFTCAGDPSTAPTARI
GVSDIHVDGQGSLLLRSAADTLASTMLVDPAKPSRVVWHAWPTTGTDPRGVWRVEMNGDV
LTSDPVALPPGTWTRTGVSGLTLHNGDWSGTIDDYITQFGKGDHWRIGLLTGDCLDSAEV
RLDDIGARTATYDFEARSWLTLRLEARTDAALLEYGDPFDVIVRANRWDADADRGRRVAG
ARVTFLRRWADGHGWRQVADARTGAAGRAVLHQTSQRRAYWRVVWHRSPTPVPSDQEYQG
SDVAFGAPLVDGRRCRVVDDYPMTCARVTVSRGRVVLSGRGRPGGSAVVHLYLYRDESHG
EPLLHRQDRLDRHGRWRIAFLTGSRHELFAQLGAKPTSDRHWVSYNPGIPLRVR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgcgctggccctgctgctcgccgtcccgctgctgggcctggcaaccgcaggg
gcgccacccgcggtcggcggcgagacgttctaccaggtcgtgcgcgagctcgacggccgc
ttcgacgcggcgggcttcacgtgcgccggtgacccgagcacggcgcccacggcccgcatc
ggcgtctccgacatccacgtggacgggcaaggcagcctgctcctgcgcagcgccgcggac
acgctggcgagcacgatgctcgtcgatccggccaagccgagccgggtggtgtggcacgcc
tggccgacgaccggcacggacccacgcggggtgtggcgggtcgagatgaacggcgacgtc
ctgaccagcgacccggtcgcgctgccgcccggcacctggacccgcaccggcgtcagcggc
ctgacgctccacaacggcgactggtcgggcacgatcgacgactacatcacccagttcggg
aagggcgaccactggcggatcggcctgctcaccggcgactgcctggacagcgccgaggtg
cggctggatgacatcggcgcccgcacggcgacgtacgacttcgaggcgcgcagctggctc
acgctccggctcgaggcacggaccgacgcggccctgctcgagtacggcgaccccttcgac
gtcatcgtccgggccaaccgctgggacgccgacgcggaccgcggccgccgggtcgcgggc
gcccgggtgacgttcctgcgccggtgggccgacggacacggctggcggcaggtcgcggac
gcgcgcaccggcgcggccggccgcgccgtgctgcaccagacgtcgcagcggcgggcgtac
tggcgggtcgtgtggcaccgctcgccgaccccggtgcccagcgaccaggagtaccagggc
tcagacgtcgccttcggcgcgccgctcgtggacggccgccgctgccgggtcgtcgacgac
tacccgatgacgtgcgcgcgggtcaccgtgtcccggggccgggtcgtgctgtccgggcgg
ggccggcccggcggctcggccgtcgtgcacctgtacctctaccgggacgagtcccacggc
gagcccctgctgcaccgccaggaccgtctcgaccggcacggccggtggcgcatcgccttc
ctcaccggctcccgtcatgagctgttcgcccagctgggcgcgaagccgacctcggaccgc
cactgggtctcctacaacccggggatcccgctgcgggtgcgctga

DBGET integrated database retrieval system