KEGG   Nocardioides sp. JS614: Noca_3720Help
Entry
Noca_3720         CDS       T00443                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EthD MmlI
Motif
Other DBs
NCBI-ProteinID: ABL83220
UniProt: A1SN35
Position
3948128..3948805
Genome map
AA seq 225 aa AA seqDB search
MTKLVFALWGDGLPTSLHDPGLHGRLAAAGVRRLQLNVDDEQVAGAMRIPTGEPVRAVVS
VWDAEPTPVADALATAAATVHGWRVDERRRLDPPETWDGSRADALSNVAILRRPAELAHE
EWLRRWMVEHTPIAIRTQATFGYVQNVVVEPVTAGAPRVDAVVEELFPSAGMSDTHAFYG
SGGDEAELGRRLTELMASVTRIGADRDLDLVPTSRYLYALDQALG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagctggtgttcgccctctggggtgacggactgccgacgagcctccacgacccc
ggcctgcacgggcggctcgccgccgcgggggtacgccgtctgcagctcaacgtcgacgac
gagcaggtcgccggggccatgcggatcccgaccggcgaaccggtgcgcgcagtggtcagc
gtctgggacgccgagcccactccggtcgccgacgccctcgccaccgccgcggcgaccgtg
cacggctggcgggtggacgagcgccgccggctggaccctcccgagacctgggacggcagc
cgcgccgacgcgctgagcaacgtcgcgatcctgcgccgccccgccgagctggcgcacgag
gagtggctgcggcgctggatggtcgagcacacgccgatcgcgatccgcacccaagccacg
ttcggctatgtccagaacgtcgtcgtcgagccggtcaccgccggggcgccccgcgtggac
gcggtcgtcgaggagctgttcccgagcgccgggatgagcgacacgcacgcgttctacggc
agcggcggcgacgaggccgagctgggccgccggctcaccgagctgatggccagcgtcacc
cggatcggggccgaccgcgacctcgacctggtcccgaccagccgctacctctacgccctg
gatcaggcgctcgggtag

DBGET integrated database retrieval system