KEGG   Nocardioides sp. JS614: Noca_3732Help
Entry
Noca_3732         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CdiI_2
Motif
Other DBs
NCBI-ProteinID: ABL83232
UniProt: A1SN47
Position
3956576..3956860
Genome map
AA seq 94 aa AA seqDB search
METRALRHFMGAYLHQDFDLVGSVEDNLALFVRQSPALAAALSDEVADLLAHPFTDGELE
RLLDEMGCEASPPVGKTYRDWLTQIADRVRRTTA
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggagacacgagccctccgccacttcatgggcgcctacctgcaccaggacttcgatctg
gtgggttcggtcgaggacaacctcgccctgttcgtgcggcagtcacccgcgctggccgcc
gcgctgtcggacgaggtcgccgacctgctcgcgcatccattcaccgatggtgagctcgag
cggctgctcgacgagatgggctgcgaggcctctccaccggtcggcaagacctaccgcgac
tggctcactcagatcgccgaccgggtccgtcgaacgacggcctga

DBGET integrated database retrieval system