KEGG   Nocardioides sp. JS614: Noca_3736Help
Entry
Noca_3736         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABL83236
UniProt: A1SN51
Position
3958756..3959091
Genome map
AA seq 111 aa AA seqDB search
MTDLALTADDLAVRFTPAEKALGILRNVTVPRTAITSAVLVRSWRREVRGLRVGLGLPGI
RLLGTWRSRGHKQLVALRRDVPAVRIGLVGASYDELLVSTPDAERLVAELG
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctggccctgaccgccgacgacctcgcggtgcggttcacgcccgccgagaag
gcgctcgggattctgcggaacgtgaccgtgccgcgcacggcgatcacctccgccgtcctg
gtgcggtcctggcgccgcgaggtgcggggcctccgggttggtctcgggctcccgggcatc
cggctgctcggcacctggcgctcgcgcggccacaagcagctggtcgcgctgcgccgcgac
gtgccggcggtccggatcggcctggtgggcgcgtcgtacgacgagctcctggtcagcacg
cccgacgccgagcgactggtcgccgagctcggctga

DBGET integrated database retrieval system