KEGG   Nocardioides sp. JS614: Noca_3737Help
Entry
Noca_3737         CDS       T00443                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C_6
Motif
Other DBs
NCBI-ProteinID: ABL83237
UniProt: A1SN52
Position
3959106..3959597
Genome map
AA seq 163 aa AA seqDB search
MYHVGSREGLLAEVTREVEARQRALMTATYDEELPPLAAAAAYWEQTVEATLRHGPLFFE
LAAHAMQGKEHAADLKAELIAAWLPSITELCRRLGIPAPQAEIHARLALGAARGLLMDLL
VTGQREQVAQAADLLSRLLLLSAEDGGAGPHDDPGNHTGPAPR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccacgtcggctcccgcgagggactgctcgccgaggtgacccgcgaggtcgaggcc
cggcagcgggcgctgatgaccgcgacgtacgacgaggaactgccgccgctggccgccgcc
gcggcgtactgggagcagaccgtcgaggccacgctgcgccacggcccgctcttcttcgag
ctcgccgcgcacgcgatgcagggcaaggagcacgccgccgacctgaaagccgagctgatc
gctgcgtggctgccctcgatcaccgagctgtgccggcggctcgggatccccgcgcctcag
gccgagatccacgcgcgcctggccctgggcgcggcccgcgggctgctcatggacctgctg
gtgaccgggcagcgcgagcaggtcgcgcaggccgccgacctgctcagccggctgctcctg
ctctccgccgaggacggcggcgccgggccccacgacgaccccggcaaccacaccgggccg
gcgcctcgatga

DBGET integrated database retrieval system