KEGG   Nocardioides sp. JS614: Noca_3738Help
Entry
Noca_3738         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4234 Cytochrom_B_C SecY DUF4064 DUF898
Motif
Other DBs
NCBI-ProteinID: ABL83238
UniProt: A1SN53
Position
complement(3959667..3960173)
Genome map
AA seq 168 aa AA seqDB search
MTESNDSTPVSPQSASVPPPFGEATPAPAPAPAAPAYAGAAHAAPAAGPIGEVRSTGTCI
LLSIVTLGIYTWFWYYKTHDEMKRHTGEGIGGGIALILAIFVGIVSPFLSSNEVGKLYER
RGQQAPVTAATGLWFLLLGWLFLVGAIVWFVKTNNALNEYWKSVGAQA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagagcaacgactccacccctgtcagcccgcagagcgcatccgttccgccgccc
ttcggcgaggccacgcctgctcccgcgccggcgccggccgccccggcgtacgccggggcg
gcccacgcggcccccgccgccggcccgatcggtgaggtccgcagcaccgggacctgcatc
ctgctcagcatcgtgaccctggggatctacacctggttctggtactacaagacccacgac
gagatgaagcggcacacgggtgagggcatcggcggcgggatcgcgctgatcctggcgatc
ttcgtcggcatcgtgagcccgttcctgtcctccaacgaggtcggcaagctctacgagcgc
cgcggccagcaggccccggtcaccgcggccaccggcctgtggttcctgctgctgggctgg
ctgttcctcgtcggcgcgatcgtgtggttcgtcaagaccaacaacgcgctcaacgagtac
tggaagtcggtcggcgcccaggcctga

DBGET integrated database retrieval system