KEGG   Nocardioides sp. JS614: Noca_3739Help
Entry
Noca_3739         CDS       T00443                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MDMPI_N Arm-DNA-bind_3
Motif
Other DBs
NCBI-ProteinID: ABL83239
UniProt: A1SN54
Position
3960405..3961142
Genome map
AA seq 245 aa AA seqDB search
MPPWCRPHLGTRFRSTVNNLWTPAPGAGRVPEDGAVSTALTAARTTYAEASDAFVALAAQ
VPMERYAEPGLGTWDLRALIGHTGRSLVTVATYLTTRAARVDAPDAAAYFAIVSRLAHGS
ARDAIHQRGIEAGVALGAHPLAALEAAREEAELALDLLEGEDPVVETAAGGMRVSDYLPT
RTFELTVHSLDIAEAAGLEFAPPAEALADTLALATASALRLGHGVDVLLALTGRRPLAAG
TSVVP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatggtgccgaccgcacctggggacgcgcttccgatcaaccgtcaacaacctg
tggacacccgcgccgggcgccggacgcgtgccggaggatggagcggtgtcgaccgccctg
accgcagcccgcaccacctacgccgaggcctccgacgcgttcgtggccctcgccgcccag
gtgccgatggagcggtacgccgagccggggctcggcacctgggacctgcgcgcgctcatc
gggcacaccggccgctcgctggtcaccgtcgcgacctacctgacgacccgcgcggcgcgg
gtcgacgccccggacgccgcggcgtacttcgcgatcgtcagccggctcgcgcacggcagc
gcgcgcgacgcgatccaccagcgcgggatcgaggccggcgtcgcgctcggcgcgcacccg
ctcgccgccctggaggcggcacgcgaggaggccgagctcgccctggacctcctcgaaggg
gaggacccggtcgtcgagaccgccgccggcgggatgcgggtcagcgactacctgcccacc
aggacgttcgagctgaccgtgcactccctcgacatcgccgaggccgccggcctggagttc
gcgccgccggccgaggcgctcgccgacaccctcgcgctggccacggcgagcgccctgcgg
ctgggccacggggtcgacgtgctgctcgcgctcaccggtcgccggccgctggccgctggc
acctcggtcgtcccctga

DBGET integrated database retrieval system