KEGG   Nocardioides sp. JS614: Noca_3741Help
Entry
Noca_3741         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mrr_N
Motif
Other DBs
NCBI-ProteinID: ABL83241
UniProt: A1SN56
Position
complement(3961565..3962029)
Genome map
AA seq 154 aa AA seqDB search
MSAEDYCELCDLPKSQCIHGNPPAPPPPTVRKAPATRPVVRRTATSSPGSSRSTTSTRST
TAAAPARPVRHRWTPPDVFKPEILAVLSAAGGELDQDEVFLELEVRMEERLTDADHEKTP
EGELRWRYAARRARQALVAEGAMTKGRPGIWALG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgaggactactgcgagctgtgtgaccttccgaagtcccagtgcatccacggg
aacccgccggctccacccccgccgaccgtgcgcaaggcgccggccacccggcccgtcgta
cgccgaaccgcaacctcgtcgcccggatcgagcaggtcgaccacctcgaccaggtcgacc
accgcggcggcgccggcgcgaccggtccggcaccggtggaccccgccggacgtcttcaag
cccgagatcctcgcggtgctgtcggccgccggtggcgagctggaccaggacgaggtcttc
ctcgagctcgaggtccggatggaggagcggctcaccgacgccgaccacgagaagacgccc
gagggcgagctgcgctggcgctacgccgcgcggcgggcccggcaggcgctggtggccgag
ggcgcgatgaccaagggacgtccggggatctgggccctgggttga

DBGET integrated database retrieval system