KEGG   Nocardioides sp. JS614: Noca_3742Help
Entry
Noca_3742         CDS       T00443                                 

Definition
(GenBank) transcriptional regulator, ArsR family
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_5 HTH_20 MarR_2 HTH_24 MarR PaaX TrmB Rrf2 HTH_IclR RP-C HTH_41 HTH_Crp_2 Penicillinase_R HTH_27 GPP34 GntR HTH_1 HTH_34 BLACT_WH Cdc6_C DUF4423
Motif
Other DBs
NCBI-ProteinID: ABL83242
UniProt: A1SN57
Position
complement(3962104..3962454)
Genome map
AA seq 116 aa AA seqDB search
MSARSALPVLDDTGGCCVPVARGLLDAEEAQNLARVFKALGDPTRLRLLSMIAAHPEREA
CICDLIEPVGLSQPTVSHHMKQLVDAGLVTREQRGRWAFYRLVDDTLTSLSSALLP
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctcgatccgccctccctgtcctcgacgacaccggcggctgttgcgtcccggtc
gcccgcgggctgctcgacgccgaggaggcgcagaacctggcgcgggtgttcaaggcgctg
ggggacccgacccggctgcgcctgctctcgatgatcgccgcccatcccgagcgcgaggcc
tgcatctgcgacctcatcgagccggtcgggctctcccagccgacggtgtcccatcacatg
aagcagctggtcgacgccgggctcgtgacccgcgagcagcgcggtcgctgggcgttctac
cgattggtggacgacaccctcacgagcctcagcagcgccttgctcccctga

DBGET integrated database retrieval system