KEGG   Nocardioides sp. JS614: Noca_3744Help
Entry
Noca_3744         CDS       T00443                                 

Definition
(GenBank) arsenical-resistance protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBF
Motif
Other DBs
NCBI-ProteinID: ABL83244
UniProt: A1SN59
Position
3963347..3964438
Genome map
AA seq 363 aa AA seqDB search
MSDTAAAQVRADVVGRLPTLDRYLPVWIGLAMAAGLLLGRWVPGIADVLDAITIASVSLP
IALGLLVMMYPVLAKVRYNEVGDVARDTRMMALSVVLNWVVGPALMFTLAWVFLADLPEY
RTGLIIVGLARCIAMVIIWNDLACGDREAAAVLVALNSVFQVLAFALLGWFYLDLLPGWL
GLSGTGLEVSPWQIAWSVVVFLGIPLAAGYLSRRAGERRRGREWYEQRFLPRIGPWALYG
LLFTIVVLFALQGDTITNQPADVARIAVPLVVYFALMWGGSMLAAHRAGLGYRRSTTVAF
TAAGNNFELAIAVAIAVYGVTSGQALAGVVGPLIEVPVLVGLVYVSLWARRFFPDTVQED
LPR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacactgcagcggcgcaggtccgtgccgacgtcgtcggccggctccccacgctc
gaccggtacctgccggtgtggatcgggctggcgatggcggccgggctgctgctcggccgc
tgggtgcccggcatcgccgacgtcctcgacgcgatcacgatcgcctcggtgtcgctgccg
atcgcgctcgggctgctggtgatgatgtaccccgtcctcgccaaggtccgctacaacgag
gtgggcgacgtcgctcgcgacacccgcatgatggcgctgtcggtggtgctgaactgggtc
gtcggtccggccctgatgttcaccctggcctgggtgttcctcgccgacctgcccgagtac
cgcaccgggctgatcatcgtgggcctggcccggtgcatcgcgatggtgatcatctggaac
gacctcgcctgcggggaccgggaagcggcggccgtcctggtcgccctgaactcggtcttc
caggtgctcgccttcgccctgctcggctggttctacctcgacctgctgcccggctggctc
ggcctctccggcaccgggctggaggtgtcgccctggcagatcgcctggagcgtggtggtg
ttcctcggcatcccgctcgctgccggctacctcagccgccgggcgggagaacgacgccgc
ggccgcgagtggtacgagcagcggttcctgccacggatcgggccgtgggcgctgtacgga
ctcctgttcaccatcgtggtgctgttcgcactgcagggcgacaccatcaccaaccagccg
gccgacgtcgcgcgcatcgccgtccccctggtcgtctacttcgccctgatgtggggcggg
tcgatgctggccgcccaccgtgcggggctcggctaccgccgatccaccacggtcgccttc
acggcagccggcaacaacttcgagctcgcgatcgcggtggccatcgccgtgtacggcgtc
accagcgggcaggcgctcgcgggagtcgtcggcccgctgatcgaggtgcccgtcctcgtc
ggcctggtctacgtgagcctctgggcccgccgcttcttccccgacaccgtccaggaggac
ctaccccgatga

DBGET integrated database retrieval system