KEGG   Nocardioides sp. JS614: Noca_3749Help
Entry
Noca_3749         CDS       T00443                                 

Definition
(GenBank) aldo/keto reductase
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red HDPD
Motif
Other DBs
NCBI-ProteinID: ABL83249
UniProt: A1SN64
Position
complement(3969313..3970293)
Genome map
AA seq 326 aa AA seqDB search
MEQRTLGRTGRPVSVVGLGTWQLGADWGDVSEDDALAVLGASVDAGVTFFDTADVYGDGR
SEQVIGRFLREHPEVVVATKMGRRVEQLPEHYTLESFRAWTDRSRRNLGVDTLDLVQLHC
PPSAVIDADATYDALDTLVADGAIAAYGVSVETVDQALSAIARPHVASIQIILNAFRLKP
LDRVLPAAAEAGVAIIARVPLASGLLSGRYDEHTTFAPDDHRSYNRDGSAFDVGETFSGV
DYETGVRAAQEFSQLVRDLDLTPAQAAIAWVVQQPGVTTVIPGARNAEQARANAVAGLAG
PLPGSVLDGVTRIYDTRLRAAIHDRW
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcgcaccctcggccggaccgggcgtccggtctccgtggtcggactcggcacc
tggcagctcggcgcggactggggggacgtctccgaggacgacgccctcgccgtcctcggc
gcctcggtcgacgccggtgtcacgttcttcgacaccgccgacgtgtacggcgacgggcgc
agcgaacaggtgatcggccggttcctgcgcgagcaccccgaggtcgtcgtggccaccaag
atgggtcgtcgcgtcgagcagctgcccgagcactacacgctcgagagcttccgggcctgg
accgaccggtcgcgacgcaacctcggcgtcgacaccctcgacctcgtgcagctgcactgc
cccccgagcgcggtcatcgacgcggacgcgacgtacgacgcgctcgacacgctggtcgcc
gacggcgcgatcgcggcgtacggcgtgagcgtcgagaccgtcgaccaggcattgtccgcc
atcgcgcgcccgcacgtcgcgtcgatccagatcatcctcaacgcgttccgcctcaagccg
ttggaccgggtgctgccggcggcggcggaggccggggtcgcgatcatcgcccgggtgccg
ctcgcgtccggcctgttgtcgggtcgctacgacgagcacacgacgttcgccccggacgac
caccgcagctacaaccgcgacggcagcgccttcgacgtgggggagacgttctcgggcgtc
gactacgagaccggcgtccgcgcggcgcaggagttctcgcagctggtgcgtgacctggac
ctgacgcccgcgcaggcggcgatcgcgtgggtggtgcagcagccgggcgtcaccacggtg
atcccgggcgcccgcaacgccgagcaggcgcgcgccaacgcggtcgccggactggccggg
ccgctgcccggctccgtcctggacggggtcacgcggatctacgacacgaggctccgcgcg
gcgatccacgaccgctggtag

DBGET integrated database retrieval system