KEGG   Nocardioides sp. JS614: Noca_3750Help
Entry
Noca_3750         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coagulin
Motif
Other DBs
NCBI-ProteinID: ABL83250
UniProt: A1SN65
Position
complement(3970323..3970865)
Genome map
AA seq 180 aa AA seqDB search
MSAARVVPFLAALALVAALVPPAVAAPPTERTITDAREPDKAYDVLSVTLTSAPAPGRKA
KVVIRHARPVEVRDSIDFWVDTDDDRVPDLFVTGPSFSEYAVYKTSSWTHHGRNITDQQC
ASLRMNQRRSVVRFDPSCLEPSVRFAVSVRSYQMDAPARTDDYVPGKHRLSRKVLSYLPG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgctcgggtcgttccgttcctcgccgccctcgccctggtcgcggcgctcgtc
ccaccggccgtcgcggcgccgccgaccgagcgcacgatcaccgacgcgcgtgagcccgac
aaggcgtacgacgtgctctcggtgaccctgacctcggccccggcccccggccgcaaggcc
aaggtcgtcatccggcacgcccggccggtcgaggtccgcgactcgatcgacttctgggtg
gacaccgacgacgaccgggtgccggacctgttcgtcactggcccgtccttctccgagtac
gccgtctacaagacgagctcgtggacccaccacggtcgcaacatcaccgaccagcagtgc
gcgtcgctgcggatgaaccagcgccggtcggtcgtccggttcgaccccagctgcctggag
ccctcggtgcggttcgcggtgtccgtgcggtcctaccagatggacgccccggcccgcacc
gacgactacgtgcccggcaagcaccggctctcgcggaaggtgctctcctacctccctggg
tga

DBGET integrated database retrieval system