KEGG   Nocardioides sp. JS614: Noca_3753Help
Entry
Noca_3753         CDS       T00443                                 

Definition
(GenBank) 23S rRNA m(5)U-747 methyltransferase
  KO
K03212  23S rRNA (uracil747-C5)-methyltransferase [EC:2.1.1.189]
Organism
nca  Nocardioides sp. JS614
Brite
KEGG Orthology (KO) [BR:nca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nca03009]
    Noca_3753
Enzymes [BR:nca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.189  23S rRNA (uracil747-C5)-methyltransferase
     Noca_3753
Ribosome biogenesis [BR:nca03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Noca_3753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_U5-meth_tr Methyltransf_31 MTS Methyltransf_25 Methyltransf_11 Methyltransf_15 Methyltransf_23 Cons_hypoth95 Methyltransf_12 Ubie_methyltran Methyltransf_4 Met_10
Motif
Other DBs
NCBI-ProteinID: ABL83253
UniProt: A1SN68
Position
complement(3971620..3972759)
Genome map
AA seq 379 aa AA seqDB search
MLCSHFDAGRCRSCTWLGTAYAAQLGAKQHTVEELLARSVGAAGATAWLPPVASAQLGVR
NKAKMVVSGTLAEPTLGILNPAGAGVDLRDCPLHTPGIQAALPVLADFVTRAALAPYDLA
TRRGELKYLLVTESPDGELMVRFVLRSQEPVARIRKHLPALLERLPQVAVATVNLQPEHK
AVLEGEREIVLTEQESLLMQVGGLGLHLRPQSFFQTNTAMAAELYRLARAWTAELAPGRV
WDLYCGVGGFALAIASTAHAEVTGVEVSGEAIASATASAREAGLDRVRFEAGDATAWVSD
RPDVPDLVVVNPPRRGLGPELSGWLEDSGVRHVLYSSCNAHTLARDLDAMPSLRPVRAQL
LDMFPNTAHYEVLALLERL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgctctgctcccacttcgacgccggacgctgccggtcctgcacctggctcggcacggcg
tacgccgcgcagctgggcgccaagcagcacaccgtcgaggagctgctcgcccggtcggtc
ggcgccgccggggcgacggcctggctgccgccggtcgccagcgcccagctgggcgtgcgc
aacaaggcgaagatggtggtcagcggcaccctcgcggagccgacgctcggcatcctgaac
ccggccggcgccggggtggacctgcgcgactgcccgctgcacacgccgggcatccaggca
gcgctcccggtgctcgccgacttcgtgacccgggccgcgctggcgccgtacgacctggcc
actcgcaggggtgagctgaagtacctgctggtcaccgagtcaccggacggtgagctgatg
gtgcggttcgtgctgcgctcccaggagccggtggcgcggatccgcaagcacctgcccgcg
ctgctcgagcggctgccgcaggtcgcggtcgcgaccgtgaacctccagcccgagcacaag
gcggtcctggagggcgagcgcgagatcgtgctcaccgagcaggagtcgctgctgatgcag
gtcggcggcctcgggctgcacctgcggccgcagagcttcttccagaccaacaccgcgatg
gccgccgagctctaccggctcgcccgcgcgtggacggccgagctggccccgggccgggtc
tgggacctgtactgcggggtgggcggcttcgccctcgcgatcgcgtccacggcgcacgcg
gaggtcaccggcgtcgaggtcagcggcgaggcgatcgcctcggcgaccgccagcgcgcgg
gaggcggggctcgaccgcgtgcggttcgaggccggcgacgccaccgcctgggtgtcggac
cggcccgacgtcccggacctggtcgtcgtgaacccgccgcgacggggcctcggccccgag
ctcagcggctggctcgaggactcgggcgtgcggcacgtcctgtactccagctgcaacgcc
cacacgctggcccgcgacctggacgcgatgccctcgctgcgcccggtgcgcgcgcagctg
ctcgacatgttcccgaacaccgcgcactacgaggtcctcgcgctgctggagcggttgtga

DBGET integrated database retrieval system