KEGG   Nocardioides sp. JS614: Noca_3754Help
Entry
Noca_3754         CDS       T00443                                 

Definition
(GenBank) conserved repeat domain
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF11 NPCBM_assoc
Motif
Other DBs
NCBI-ProteinID: ABL83254
UniProt: A1SN69
Position
3972972..3975377
Genome map
AA seq 801 aa AA seqDB search
MVTSGRIANRTHVVLSGLLGLLVALALVVVPGTPLAGPARAAGDPPGNNGTVKIAEHGEL
DGTPDNDPHVGCEFEVEWYGFDQGSDIISTVTFEMQAPTDDVVLDVTGPAAVFVGGDPAS
GAGTGTGLDGRETYTLAFYGEPQPLQGYHVKLTIHTPGSQGADKKSKVFWVEGCEPVVPD
GPGIHVEKSVTDSADADTVGSFGEQLTYGFVVTNVGDTTLEDVTLTDDLLGLAAAPCVAT
LAPGESTTCPLLPTPTYVVTSADVAAGRVWNLATATGTPPSGPDVSDSDDAAIPTGPGEP
EPAGLAVVKTADVSLAAPGDLVTYTLRAVNSGPGAAEDVVITDVLPAGASFVSAGAGCTY
AAPTVTCALGDLAAGGQRSVTVTVRVSLLPSTVTTHDHLFDVTKIESHLSAFAGQTATAT
TSCPTGYLATDGSVRIDHIDQNAGTWPDVDVLASATTADGRGWTGTLRNGTTGQVQAKVN
VVCMSERTVSGEDHSHPLVVSDVLSTTQAWAAGPHSVDLSCGPGAVAIAPGFAFLEGDGV
VASRPISDGRRFVGDIDDDALVTLTARCLRTTLGVARGHTHELLTSELSGHVDVAPGALV
ERSLTCRDGAKGIVAWVDPHGTLPLGNDPQPVTRVFRFYNPSAGSLTVDYGLLCVDVRTS
PAEEESRQVENTATVATSSPDSATFDDTSTATITVSATGVSAGGSGWVNAGRTSVQVRVA
TEVRRHVSLKLIATHRVAGAPVRRGTVLAQGKAVVRKAQPTVRLAVTKAARAALRGDRIH
RARLVVTGPGGARDARLITLR
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
gtggtcacgtctggtcgtattgccaaccgcacgcacgtcgtcctgagcgggctgctcggc
ctgctcgtcgcgctcgcgctcgtcgtcgtcccggggacgccactggccgggcccgcccgg
gccgcaggcgatccgccgggcaacaacgggacggtcaagatcgccgagcacggcgagctc
gacgggacgccggacaacgacccgcacgtcggctgcgagttcgaggtcgagtggtacggc
ttcgaccagggatccgacatcatctcgaccgtcacgttcgagatgcaggccccgaccgac
gacgtcgtcctcgacgtcaccggtcccgccgcggtcttcgtaggtggcgacccggcgagc
ggcgccggcaccggcaccggcctggacggccgcgagacctacacgctcgcgttctacggc
gagccgcaaccgctgcagggttaccacgtcaagctgaccatccacacgcccggatcgcag
ggtgcggacaagaagtcgaaggtcttctgggtcgagggctgcgaacccgtcgtgccggac
gggcccgggatccacgtcgagaagagcgtcacggactccgccgacgccgacaccgtcggc
tcgttcggcgagcagctgacctacggcttcgtggtcaccaacgtcggcgacacgacgctc
gaggacgtcacgctcaccgatgacctgctcgggctggccgccgcaccctgcgtcgcgacc
ctcgcgccgggtgagtcgacgacctgcccgctcctgccgaccccgacgtacgtcgtcacc
tcggcggacgtggccgccggccgggtgtggaacctcgccaccgcgaccgggaccccgccg
tccggcccggacgtgtccgactccgacgacgcggcgatccccacgggacccggcgagccg
gagcccgccggcctggcggtcgtcaagaccgcggacgtcagcctcgccgcgccgggtgac
ctggtcacctacaccctgcgcgccgtgaacagcggccccggcgccgccgaggacgtcgtc
atcaccgacgtgctgcccgccggcgccagcttcgtctcggccggtgccggctgcacctac
gccgccccgaccgtcacctgcgccctcggcgacctcgccgccggagggcagcggtcggtc
accgtgaccgtgcgggtcagcctgctgccgagcaccgtcaccacccacgaccacctcttc
gacgtcacgaagatcgagagccacctgtcggcgttcgccggccagaccgccaccgccacc
acctcgtgcccgaccgggtacctcgcgaccgacggcagcgtccggatcgatcatatcgac
cagaacgccgggacctggcccgacgtcgacgtgctggcctcggccaccacggccgacggc
cggggctggaccgggacgctgcgcaacggcaccaccggccaggtccaggccaaggtcaac
gtcgtctgcatgagcgagcggaccgtctccggcgaggaccactcgcacccgctggtggtc
tccgacgtgctgagcacgacccaggcgtgggcggccggtccgcacagcgtcgacctgtcc
tgcggacccggcgcggtcgcgatcgcacccggcttcgccttcctcgagggcgacggcgtg
gtcgccagccgcccgatctccgacggccgacggttcgtgggggacatcgacgacgacgcc
ctggtcacgctgaccgcgcggtgcctgcggaccacgctcggcgtggcgcgcggccacacc
cacgagctgctcacctccgagctctccggccacgtggacgtcgcgccgggcgccctggtc
gagcggagcctcacctgccgcgacggcgccaaggggatcgtcgcctgggtcgacccgcac
ggcaccctgccgctcggcaacgacccgcagccggtgacgcgggtgttccggttctacaac
ccgtccgccgggtcgctgaccgtggactacggactgctctgcgtcgacgtgcgtaccagc
ccggccgaggaggagagccgtcaggtggagaacaccgccaccgtggcgaccagcagcccg
gactccgcgaccttcgacgacacctcgaccgccacgatcacggtcagcgcgacgggcgtc
tcggccggcggctcgggctgggtcaacgccggccggaccagcgtccaggtccgggtcgcg
accgaggtacgccgccacgtctcgctgaagctgatcgccacccaccgggtcgcgggcgcg
cccgtgcgccgcggcaccgtgctggcccaagggaaggcggtcgtccggaaggcccagccc
accgtccgcctggccgtgaccaaggccgcccgcgcggcgttgcgcggcgaccggatccac
cgggcccgcctggtggtgaccggtcccggcggcgcccgcgacgcacggctgatcacgctg
cgctga

DBGET integrated database retrieval system