KEGG   Nocardioides sp. JS614: Noca_3756Help
Entry
Noca_3756         CDS       T00443                                 

Definition
(GenBank) 2-amino-3-ketobutyrate coenzyme A ligase
  KO
K00639  glycine C-acetyltransferase [EC:2.3.1.29]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00260  Glycine, serine and threonine metabolism
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noca_3756
Enzymes [BR:nca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.29  glycine C-acetyltransferase
     Noca_3756
Amino acid related enzymes [BR:nca01007]
 Aminotransferase (transaminase)
  Class II
   Noca_3756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 SHMT Flg_hook Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABL83256
UniProt: A1SN71
Position
complement(3976841..3978034)
Genome map
AA seq 397 aa AA seqDB search
MYGDVKQQLAQTLAEIESAGLYKREREITTPQAAHIATTAGEALNFCANNYLGFSDHPDV
IAASKAALDTWGFGMSSVRFICGTQTQHTELERRLSEFLHTEATILYSSCFDANGGVFEV
LCGEEDAIVSDELNHASIIDGIRLSKAARYRYKNADLADLRDQLVAAREAGARRVLIATD
GVFSMDGSFAPLSEICDLADEFSALVLVDDSHAVGFVGPGGRGTPELFGVLDRVDIITGT
LGKALGGASGGYVASHQEIVDLLRQRSRPYLFSNSVAPGVVAGSLAALDLVTSSSEARDT
LEENSALFRSLMTEAGFSLLPGTHPITPVMFPGEDGARLATAIADDMLAQGVYVIAFSFP
VVPRGKARIRVQLSAAHSEDDVRRCVAAFVAARDAQA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcgacgtgaagcagcagctggcccagacccttgcggagatcgagagcgcgggg
ctctacaagcgcgagcgcgagatcaccacgccacaggcggcgcacatcgcgaccaccgcg
ggcgaggcgctgaacttctgcgcgaacaactacctcgggttctccgaccaccccgacgtg
atcgcggccagcaaggcggcgctggacacctggggcttcgggatgagctcggtgcggttc
atctgcggcacccagacccagcacacggagctggagcggcggctctcggagttcctgcac
accgaggcgacgatcctctacagctcctgcttcgacgccaacggcggcgtcttcgaggtg
ctgtgcggtgaggaggacgcgatcgtctccgacgagctcaaccacgcctcgatcatcgac
ggcatccggctgagcaaggcggcgcggtatcgctacaagaacgccgacctggccgatctg
cgcgaccagctggtcgcggcccgcgaagccggcgcacggcgggtgctgatcgcgaccgac
ggcgtgttctcgatggacggcagcttcgcgccgctgtcggagatctgcgacctggccgac
gagttctccgccctcgtgctggtcgacgactcccacgccgtggggttcgtgggtcctggc
gggcgcggcacgccggagctgttcggggtgctggaccgggtcgacatcatcaccggcacc
ctgggcaaggcgctcggcggtgcgtcgggcggctacgtcgcctcccaccaggagatcgtg
gacctgctgcggcagcgctcgcggccctacctgttctcgaactcggtcgcacccggcgtc
gtcgccggttcgctcgcggccctggacctggtgacctcctcgagcgaggcgcgcgacacc
cttgaggagaacagcgcgctgttccggtcgctgatgaccgaggccggcttctcgctgctg
cccggcacgcacccgatcacgccggtgatgttccccggcgaggacggcgcccggctcgcc
accgccatcgcggacgacatgctcgcccagggtgtctacgtgatcgcgttctcgttcccg
gtggtgccgcggggcaaggcccggatccgggtccagctctcggccgcgcactcggaggat
gacgtccgccgctgcgtggcggcgttcgtcgcggcccgggacgcccaggcctga

DBGET integrated database retrieval system