KEGG   Nocardioides sp. JS614: Noca_3757Help
Entry
Noca_3757         CDS       T00443                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00260  Glycine, serine and threonine metabolism
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noca_3757
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Noca_3757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABL83257
UniProt: A1SN72
Position
complement(3978036..3979076)
Genome map
AA seq 346 aa AA seqDB search
MRALVKTTAGPGLELIDVPEPACGDRDVKIRVLRAGLCGTDLHLLSWDDWAAATVQAPMT
IGHEFFGEVVEVGADVDHVSVGDRVSGEGHIVCGACRNCRAGRRQLCINTVGVGVNRDGA
FADYVVIPAANAWVQPADLDPDLGALFDPLGNATHTALQWPVVGEDVVITGAGPIGIMAT
AIVRHAGARRIAVTDLSPERLELAASAGADLTVDVSQGQDLAWAQRQLGMLEGFDIGLEM
SGAPDAVRDMLENLNHGARVAMLGLPRSAYEIDWGKVITHMITLRGIYGREMFETWYLMG
SMLATTPALRDAVQSVITWRGPAEDWEEAFEHTRSGTAGKAVLDWS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgctctcgtgaagacgaccgccggacccgggctcgagctcatcgacgtgcccgag
ccggcctgtggtgaccgcgacgtgaagatccgggtgctgagagcgggcctctgcggcacc
gacctgcacctgctgtcctgggacgactgggcggccgcgacggtgcaggcgccgatgacg
atcggccacgagttcttcggggaggtcgtcgaggtcggcgcggacgtcgaccacgtctcg
gtcggcgaccgggtctccggcgagggacacatcgtgtgcggggcctgccgcaactgccgg
gccgggcggcgccagctgtgcatcaacaccgtcggcgtcggggtcaaccgggacggcgcg
ttcgccgactacgtcgtcatcccggcggccaacgcctgggtccagccggccgacctcgac
ccggacctgggtgcgctgttcgacccgctcggcaacgccacccacaccgccctccagtgg
ccggtggtgggggaggacgtcgtcattacgggggccggcccgatcgggatcatggcgacc
gcgatcgtgcggcacgcgggcgcccggcggatcgcggtcaccgacctcagccccgagcgg
ctggagctggcggcaagcgcgggcgccgacctcaccgtcgacgtctcccagggccaggac
ctggcctgggcacagcggcagctcggcatgctcgagggcttcgacatcggcctggagatg
tcgggtgctcccgacgccgtgcgcgacatgctcgagaacctcaaccacggggcccgggtc
gcgatgctgggcctgccgcggtcggcgtacgagatcgactggggcaaggtgatcacgcac
atgatcacgctgcgcgggatctatggccgcgagatgttcgagacgtggtacctgatgggc
tcgatgctggcgaccacgccggcgctgcgggacgccgtacagtccgtgatcacgtggcgt
ggcccggcggaggactgggaggaagccttcgagcacacccggtccggcaccgccggcaag
gccgtcctggattggagctga

DBGET integrated database retrieval system