KEGG   Nocardioides sp. JS614: Noca_3759Help
Entry
Noca_3759         CDS       T00443                                 

Definition
(GenBank) sodium/proton antiporter, CPA1 family
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger
Motif
Other DBs
NCBI-ProteinID: ABL83259
UniProt: A1SN74
Position
complement(3981907..3983184)
Genome map
AA seq 425 aa AA seqDB search
MTADLVYVVAGGSLLLAIVLPELLDRWAVSAPMVLVAVGIGIGFTPLPDGMPLDPQANRA
TIEHVTELAVLVALMGVGLALDRPLRPRSSASWARWSTTWRLLGITMPLCIGAVALLAWG
AGVAPAAALLLGAALAPTDPVLASDVQVAGPQTGDHEIDESDELRFTLTSEAGLNDGLAF
PFVYAAILLATEGAVSGWALEWVGFYLVGKVVIGVVAGIAVGRVLAWVAFRSASRSLRVA
ERGESLLALAALVSAYGVGEVVGGYGFLSVFVCAMTFRSAERAHDYHAAMHEVAERLERL
LTLFVLLVLGIALSRGLLGGLDWRGVVLGLGLLLVIRPLAGLVALAPFARRERPPLTRGQ
RWAAAFFGVRGVGSIYYLAYAAGHAAELGTDWLWSTVSFTVVASVLLHGVLASPVLRRVG
DPASR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccgacctcgtgtacgtcgtcgccgggggcagcctcctgctcgccatcgtgttg
ccggagctgctcgaccggtgggcggtgtccgcgccgatggtgctggtcgcggtcgggatc
ggcatcgggttcactccgctgcccgacgggatgccgttggatccgcaggccaaccgggcc
acgatcgagcacgtcaccgagctcgcggtgctggtcgcgctgatgggcgtcgggctggcc
ctcgaccggccgttgcggccgcgcagcagcgcctcctgggcccggtggagcacgacctgg
cggctgctcggcatcacgatgccgctgtgcatcggcgccgtggccctgctcgcctgggga
gccggggtcgcgccggcggcggccctgctgctcggggcggcgctcgcgccgacggacccg
gtgctcgcgtccgacgtccaggtcgccggcccgcagaccggtgaccacgagatcgacgag
tccgacgagctgcgcttcaccctcacctccgaggccgggctcaacgacgggctcgcgttc
ccgttcgtgtacgccgcgatcctgctcgcgaccgagggcgcggtctcggggtgggcgctg
gagtgggtcggcttctacctggtcgggaaggtcgtgatcggcgtcgtcgcgggcatcgcg
gtcggacgggtgctggcctgggtcgcgttccgctccgcgagccggtcgctgcgggtggcc
gagcgcggggagtcgctgctggcgctcgcggccctggtgtcggcgtacggtgtcggcgag
gtcgtcggcggctacggcttcctctcggtgttcgtctgcgcgatgacgttccggtcggcg
gagcgcgcccacgactaccacgcggcgatgcacgaggtcgccgagcggctcgagcgactg
ctcacgctgttcgtgctgctggtgctcggcatcgcgctcagccgcgggctgctgggcggg
ctcgactggcgcggcgtcgtcctcggcctcggtctgttgctcgtgatccgcccgctcgcg
gggctggtcgcgctcgcgccgttcgcccgacgggagcgcccaccgttgacccggggccag
cggtgggcggcggcgttcttcggcgtccgcggcgtcggctcgatctactacttggcctac
gccgccggacacgccgcggagctgggcacggactggttgtggtccacggtctcgttcacg
gtcgtcgcctcggtgctcctgcacggcgtgctcgcctcaccggtgctgcgccgcgtcggt
gatcctgcgagcaggtga

DBGET integrated database retrieval system