KEGG   Nocardioides sp. JS614: Noca_3762Help
Entry
Noca_3762         CDS       T00443                                 

Definition
(GenBank) PE-PGRS family protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABL83262
UniProt: A1SN77
Position
3985173..3985607
Genome map
AA seq 144 aa AA seqDB search
MVAALRRSRGLDKLDHRSRAVGRAASASERRRDPGSEGRASTIDGYAKVATAPRRSRGLD
KLDHRSRAVGRAASASERRRDPGSEGRASTIDGYAKMVAALRRSRGLDKLDHRSRAVGRA
ASASERRRDPGSQGRASAIVLAPA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgccgccctgcgcaggtccaggggtctcgacaagctcgaccaccgcagccgcgcc
gttggtcgagcagcgagcgccagcgagcgtcgtcgagaccccggaagtgaaggcagggcc
tcgaccatcgacggctacgcgaaggtggccaccgccccgcgcaggtccaggggcctcgac
aagctcgaccaccgcagccgcgccgttggtcgagcagcgagcgccagcgagcgtcgtcga
gaccccggaagtgaaggcagggcctcgaccatcgacggctacgcgaagatggtcgcggcc
ctgcgcaggtccaggggtctcgacaagctcgaccaccgcagccgcgccgttggtcgagca
gcgagcgccagcgagcgtcgtcgagaccccggaagccaaggcagggcctcagccatcgtc
cttgcgccggcgtga

DBGET integrated database retrieval system