KEGG   Nocardioides sp. JS614: Noca_3763Help
Entry
Noca_3763         CDS       T00443                                 

Definition
(GenBank) Excinuclease ABC, C subunit domain protein
  KO
K07461  putative endonuclease
Organism
nca  Nocardioides sp. JS614
Brite
KEGG Orthology (KO) [BR:nca00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Noca_3763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIY-YIG T5orf172
Motif
Other DBs
NCBI-ProteinID: ABL83263
UniProt: A1SN78
Position
complement(3985581..3985886)
Genome map
AA seq 101 aa AA seqDB search
MAWTYIVECADGSLYVGSTIDLDRRISQHNLGLGSAYTRLKRRPPVRLAWAVFYDRVDDA
YDFEKQIQGWGRAKRIALIEGRLDDLPALARSRSRRRKDDG
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggcctggacctacatcgtcgagtgcgccgacggctcgctgtacgtcggcagcaccatc
gacctggaccgtcggatcagccagcacaacctcgggctcggttcggcgtacaccaggctc
aagcgccgtccgccggtgcggctggcgtgggccgtcttctacgaccgcgtcgacgacgcc
tacgacttcgagaagcagatccaaggctgggggcgtgcgaagcggatcgccctcatcgag
ggccggctcgacgacctgcctgcgctcgcccgaagccggtcacgccggcgcaaggacgat
ggctga

DBGET integrated database retrieval system