KEGG   Nocardioides sp. JS614: Noca_3767Help
Entry
Noca_3767         CDS       T00443                                 

Definition
(GenBank) fatty acid desaturase
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: ABL83267
UniProt: A1SN82
Position
complement(3988361..3989515)
Genome map
AA seq 384 aa AA seqDB search
MTTMQVRPRTAPGGLTTDEVELLGKELDAIRQGVLDSRGARDAAYIRRVVQVQRMLELGS
RAVLLRSRRPAAWVVGTAGLAIAKILDNMEIGHNVLHGQWDWMRDPKIHSSTWEWDHVTP
AAQWKRAHNETHHTYTNIRGLDNDLGYGIMRVDEAQEWQPRYLVQPAWNFVTACIFEYGI
AMFDLDLGDHLRDKRQMTPEKKAEVKVALAKAGRQLTKDFVLYPALSGRGWRSTLAADAT
ANLVRNLWSHSVIMCGHFPEGVQTFEQAELDENETRGSWYLRQMLGSANISGSRLLHLMT
GNLSHQIEHHIFPDLPSNRYAEIAPRVREVFARFDLAYNARPMVKQVASAWHKVIRLSLP
NGWLAETNRRNLVPQLRRLAVRPA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatgcaggtgcgcccgcggacggcgccgggcgggctcacgaccgacgaggtc
gagctgctcggcaaggagctcgacgcgatccggcagggcgtgctcgacagccgtggcgca
cgggacgcggcgtacatccgccgggtcgtccaggtgcagcggatgctcgaactcggcagc
cgggcggtgctgctgcgcagccggcgccccgccgcgtgggtggtcggcaccgccgggctc
gcgatcgccaagatcctcgacaacatggagatcgggcacaacgtcctgcacggtcagtgg
gactggatgcgcgaccccaagatccactccagcacctgggagtgggaccacgtcaccccc
gcggctcagtggaagcgcgcccacaacgagacccaccacacctacacgaacattcgcggc
ttggacaacgacctcgggtacggcatcatgcgcgtcgacgaggcgcaggagtggcagccg
cgctacctcgtgcagcccgcgtggaacttcgtgaccgcctgcatcttcgagtacggcatc
gcgatgttcgacctcgacctcggcgaccacctccgcgacaagcgccagatgacgccggag
aagaaggcggaggtcaaggtggcgctcgccaaggccggccgccagctgaccaaggacttc
gtgctgtacccggcgctgtcgggtcgcggctggcgctcgacgctcgcggcggatgcgacc
gcgaacctggtgcgcaacctgtggagccactcggtgatcatgtgcgggcacttccccgag
ggcgtgcagaccttcgagcaggccgagctcgacgagaacgagacccgcgggagctggtac
ctgcgccagatgctcggctcggcgaacatctccggctcgcggctgctgcacctgatgacc
ggcaacctgtcccaccagatcgagcaccacatcttccccgacctgccgagcaaccggtac
gccgagatcgcgccccgggtgcgggaggtgttcgcgaggttcgacctggcctacaacgcc
cggccgatggtcaagcaggtcgccagcgcctggcacaaggtgatccggctctcgctgccc
aacggctggctggccgagaccaaccggcgcaacctggtccctcagctcaggaggttggcg
gtccgtcccgcctga

DBGET integrated database retrieval system