KEGG   Nocardioides sp. JS614: Noca_3855Help
Entry
Noca_3855         CDS       T00443                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00900  Terpenoid backbone biosynthesis
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Noca_3855
Enzymes [BR:nca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Noca_3855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABL83353
UniProt: A1SNG8
Position
complement(4073974..4074867)
Genome map
AA seq 297 aa AA seqDB search
MRAPAKVNLHLGVGAPREDGFHPLVTVYQAVGLYDDVTARAAPDWSVGVGLPDWMDDDAV
PLNGANIVDRAADLLAAHHGVERTGELHIAKAIPVAGGMAGGSADAAAALVALDRLWGLD
TSDDDLLALAARLGSDVPFALLGGTALGTGRGEVVTPVQDRGTWWWVVVPSDTGLSTPEV
YRHFDRMFPDAPSQPVPADALLGAIAAGDTWALADALHNDLEAAAIDLRPELGRLIERGE
EAGALRGLVSGSGPTCVFLCGSADHARSLAADLSGAGHPVVLAANGPVAGAHLVSYA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcgcccgccaaggtcaacctgcacctcggggtcggcgcgccccgcgaggacggc
ttccatccgctggtgacggtctaccaggcggtcgggctctacgacgacgtcacggcgcgc
gcggcgccggactggagcgtgggcgtgggcctgccggactggatggacgacgacgccgta
cccctcaacggcgccaacatcgtggaccgggccgcggacctgctcgcggcccatcacggc
gtcgaacggaccggggagctgcacatcgccaaggcgatcccggtcgcgggcggcatggcc
ggcggctccgccgacgccgccgcggccctggtcgccctggaccggctctgggggctggac
acctccgacgacgacctcctcgcgctcgccgcccggctgggcagcgacgtgccgttcgcc
ctgctcggcggcaccgcgctcggcaccggccggggcgaggtggtcacgccggtgcaggac
cgcggcacctggtggtgggtggtcgtcccctccgacaccgggctgtcgacccccgaggtc
taccggcacttcgaccggatgttccccgacgcaccctcccagccggtgccggccgacgcg
ctgctcggcgcgatcgccgccggcgacacctgggcgctcgcggacgccctgcacaacgac
ctcgaggcggccgcgatcgacctgcgccccgagctcggccggctgatcgagcgcggcgag
gaggccggggcgctgcgcggcctggtgtccgggtccggcccgacctgcgtcttcctgtgc
ggctccgccgaccacgctcgctcgctggccgccgacctgtccggcgccggtcatcccgtc
gtcctcgccgccaacgggccggtcgccggcgcgcacctggtctcctatgcctag

DBGET integrated database retrieval system