KEGG   Nocardioides sp. JS614: Noca_3949Help
Entry
Noca_3949         CDS       T00443                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00260  Glycine, serine and threonine metabolism
nca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01130  Biosynthesis of antibiotics
nca01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noca_3949
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Noca_3949
Enzymes [BR:nca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Noca_3949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABL83446
UniProt: A1SNR1
Position
4161334..4162689
Genome map
AA seq 451 aa AA seqDB search
MNDDQVMFTLDESEQVTHWYNIVADLPTPPPPPLHPGTHEPVGPDDLAALFPMELILQEV
SGERYVEIPEPVREVYRQYRPSPLYRARRWEQKLGTTARIYYKYEGVSPAGSHKTNTSVP
QVYYNSLHGVRRLTTETGAGQWGTALAYACSLFDVECEVWQVGASYDSKPQRRTLIEVFG
GSVHRSPSRLTESGKAFPDGHPGSLGIAISEAVEVAAQDETTKYALGSVLNHVLLHQTVI
GEETLRQLAKAGESGADLVVGCAGGGSNFAGLAFPFLREKLAGTQAPRILAVEPTSCPTL
TRGEYRYDFGDTAGLTPLMKMYTLGHDFVPSPIHAGGLRYHGMAPLVSHAVHEGLIEATA
LHQSECFEAGLEFARTQGIVAAPESSHALAQARREALAATESGAEPVIVVGLSGHGLLEL
GAYESFLSGHLEDDPLSDADLTAALAGIPQV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgaccaggtcatgttcacgctggacgagtccgagcaggtcacccactggtac
aacatcgtggcggacctgccgacgccgcccccgccgccgctccaccccggcacccacgag
ccggtcggacccgacgacctggccgcactgttcccgatggagctgatcctccaggaggtc
agcggcgagcggtacgtcgagatcccggagccggtgcgcgaggtctatcgccagtaccgg
cccagcccgctctaccgcgcccgccgctgggagcagaagctcggcaccacggcgcggatc
tactacaagtacgagggcgtctcgcccgccgggtcgcacaagaccaacacctcggtgccg
caggtctactacaactccctgcacggggtgcgccggctcacgaccgagacgggcgccggc
cagtggggcaccgcgctggcctacgcgtgctccctgttcgacgtggagtgcgaggtctgg
caggtcggcgcgtcgtacgactccaagccgcagcgccggacgctgatcgaggtgttcggc
ggctccgtgcaccgctccccgagccggctcaccgagtccggcaaggcgttccccgacgga
cacccggggtcactgggcatcgcgatctccgaggcggtcgaggtcgccgcccaggacgag
acgaccaagtacgccctcggctcggtgctcaaccacgtgctgctgcaccagaccgtgatc
ggcgaggagacgctgcgccagctggccaaggccggtgagtccggcgccgacctcgtggtc
ggctgcgccggcggcgggtcgaacttcgccggcctcgccttcccgttcctgcgcgagaag
ctggccggcacgcaggctccccggatcctggcggtcgagcccacgtcctgcccgaccctg
acccggggcgagtaccgctacgacttcggcgacaccgccgggctgacacccttgatgaag
atgtacacgctcggccacgacttcgtgccgtcgccgatccacgcgggcgggctgcgctac
cacggcatggcgccgctggtctcgcacgccgtgcacgagggcctgatcgaggccaccgcg
ctgcaccagagcgagtgcttcgaggctggcctggagttcgcccgcacccagggcatcgtc
gcggcgcccgagtcctcgcacgcgctggcccaggcccgccgcgaggcgctcgccgcgacc
gagtccggggcggagccggtgatcgtcgtcgggctctccgggcacggcctgctcgagctc
ggtgcctacgagtcgttcctctccggccacctcgaggacgacccgctgtccgacgcggac
ctcaccgcggcgctggcgggcatcccgcaggtctga

DBGET integrated database retrieval system