KEGG   Nocardioides sp. JS614: Noca_4507Help
Entry
Noca_4507         CDS       T00443                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00010  Glycolysis / Gluconeogenesis
nca00020  Citrate cycle (TCA cycle)
nca00620  Pyruvate metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
nca01130  Biosynthesis of antibiotics
nca01200  Carbon metabolism
Module
nca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noca_4507
   00020 Citrate cycle (TCA cycle)
    Noca_4507
   00620 Pyruvate metabolism
    Noca_4507
Enzymes [BR:nca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Noca_4507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABL84004
UniProt: A1SQB9
Position
complement(4766438..4767862)
Genome map
AA seq 474 aa AA seqDB search
MPEYKLPDPGEGLTEAEIVKWHVAVGDVVEINQVVVEIETAKSIVELPSPYAGEVSAILV
AEGELVPVGTPIIAIGDDVAAEPAAGAAPEARAAAPVEIDLSNPAASGGGEGESLVGRNK
ADRGPVRRARKVTSGAMAAHMQAQAAFETGGAPMVEADEEPVPATAAAPLDAPAAVRTLA
KPPVRKLAKDLGVDLTTLTPSGPNGTVSREDVEAAAGGDAVLGGRVAAGERGGESRPAER
EWREPIKGVRKMMGQAMVQSAFTLPHVTEWVTVDVTATMELVERLKTRREFREVRVSPLL
VLARAVMLAMRRTPEINSWWDDAAHEVVYKRYVNLGIAAATPRGLVVPNVKDAESMTLLE
LAQAINAVTATAREGKTQPAEMSGGTFTITNVGVFGVDSGTPIINPGESAILAFGAVRKQ
PWVVETDGQDTIVPRQICTLALAFDHRHIDGEKGSRFLADVAEIMADPATALLY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagtacaagctgcccgacccgggcgagggcctgaccgaggccgagatcgtcaag
tggcacgtcgccgtcggcgacgtcgtcgagatcaaccaggtcgtcgtcgagatcgagacc
gcgaagtcgatcgtcgagctgccctcgccgtacgccggtgaggtgagcgcgatcctggtc
gccgagggcgagctggtcccggtcggtacgccgatcatcgcgatcggcgacgacgtggcc
gccgagccggcggccggtgccgctcccgaggcgcgcgccgcggcgccggtggagatcgac
ctgtccaaccccgccgcgtccggtggcggcgagggcgagagcctggtcgggcgcaacaag
gccgaccggggcccggtccgccgggcccgcaaggtcacctccggggcgatggccgcgcac
atgcaggcgcaggccgcgttcgagaccggcggcgcgccgatggtggaggccgacgaggag
ccggtgccggccaccgccgcggccccgctggacgctccggcggcggtgcgcaccctggcc
aagccgccggtgcgcaagctcgccaaggacctcggcgtcgacctcaccacgctcaccccg
agcgggccgaacgggaccgtgtcgcgcgaggacgtcgaggccgcggccggcggcgatgcc
gttctcggcggtcgggtagccgccggcgaacgaggcggcgagtcgagacccgctgagcgg
gagtggcgcgagccgatcaagggcgtgcgcaagatgatgggccaggcgatggtccagtcg
gcgttcacgctgccgcacgtgaccgagtgggtcaccgtcgacgtcaccgcgacgatggag
ctcgtcgagcggctgaagacgcgccgggagttccgcgaggtccgggtctcaccgctgctg
gtgcttgcccgcgcggtgatgctggcgatgcggcgcacaccggagatcaactcgtggtgg
gacgacgcggcgcacgaggtcgtctacaagcggtacgtgaacctcggcatcgccgcggcc
accccgcgcgggctggtcgtgccgaacgtcaaggacgccgagtcgatgaccctcctcgag
ctcgcccaggcgatcaacgcggtgaccgcgaccgcccgggagggcaagacccagcccgcg
gagatgagcggcggcaccttcacgatcacgaacgtcggcgtcttcggcgtcgactccggc
acgccgatcatcaaccccggcgagtccgcgatcctggcgttcggcgcggtgcgcaagcag
ccctgggtggtcgagaccgacggccaggacaccatcgtgccgcgccagatctgcacgctg
gcgctggccttcgaccaccgccacatcgatggggagaagggctcgcggttcctcgccgac
gtcgccgagatcatggccgatcccgccaccgcgctgctgtattga

DBGET integrated database retrieval system