KEGG   Nocardioides sp. JS614: Noca_4613Help
Entry
Noca_4613         CDS       T00443                                 

Definition
(GenBank) Thimet oligopeptidase
  KO
K01392  thimet oligopeptidase [EC:3.4.24.15]
Organism
nca  Nocardioides sp. JS614
Brite
KEGG Orthology (KO) [BR:nca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nca01002]
    Noca_4613
Enzymes [BR:nca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.15  thimet oligopeptidase
     Noca_4613
Peptidases [BR:nca01002]
 Metallo Peptidases
  Family M3
   Noca_4613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M3 DUF2587
Motif
Other DBs
NCBI-ProteinID: ABL84108
UniProt: A1SQM3
Position
complement(4887395..4889320)
Genome map
AA seq 641 aa AA seqDB search
MSLAPLALPLPDDAQEWVESLTRDGLATARERAERLRTSPPADPLDLLREWDEVARALSG
VAAAASLLANVHPLEPVRTACEAADREVDRLLTELRQDRGLYDVFAAADPAGLDPAAARL
LDKTLEDFRRAGVDLDDATRARLAEINERLTQVGQEFSRTIRDDVRTVRVPAERLAGLPQ
DWLDAHPVDADGLVTVTTDYPDAVPVRMFVHDAGVRRQVTVAFLERGWPQNEPLLREMFA
LRHELATLVGYADWASYDAGVKMIGDGPAIPAFIDRIAAAADAPMRRDLDQLLERYRRDV
PDATAIDTADSLYYEELVRQERHDVDAQRVRAYFDFTKVRRGLLEVTGRLFGLRYEPVPD
ATVWHEDVAAYDVLRDAPDGPVPVGRIYLDLHPREGKYKHAAQFTLVDGLAGRQLPEGVL
VCNFSRGLMEHDHVVTLFHEFGHLVHHVLGGHGGWTRFSGVATEWDFVEAPSQLLEEWAW
DPEVLRTFAADADGEPIPEDLVERMRAADEFGKGYHARTQMFYAAMSYWFHTSRPDDLTA
AMRELQERYSPFPYIDGTHMFASFGHLGGYSSAYYTYMWSLVIAKDLFSAFDPADLFDPV
VAGRYRDRVLALGGSRDAADLVTDFLGRPYTFDAYAAWLAR
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgcccctctcgcgctcccgttgcccgacgacgcccaggagtgggtcgagtcc
ctgacccgcgacggactcgcgaccgcccgcgagcgcgccgagcggctgcgcacgtccccg
ccggccgacccgctggacctgctccgcgagtgggacgaggtggcccgcgcgctgtccggc
gtcgcggcggccgcctcgctgctcgcgaacgtgcacccgctggagccggtgcggaccgcg
tgcgaggcggccgaccgggaggtggaccggctgctcaccgagctgcgccaggaccgcggg
ctgtacgacgtcttcgcggccgccgacccggccggcctggaccccgcggcagcacgcctg
ctcgacaagaccctcgaggacttccggcgcgccggcgtcgacctcgacgacgcgacccgg
gcccggctcgccgagatcaacgagcggctgacccaggtcggtcaggagttcagtcgcacc
atccgcgacgacgtgcgcaccgtccgggtcccggccgagcgcctcgccggcctgccgcag
gactggctcgacgcccatcccgtcgatgccgacgggctggtcacggtcaccaccgactac
ccggacgcggtgccggtccggatgttcgtccacgacgcgggcgtccggcgccaggtcacg
gtcgcgttcctggagcgtggctggccgcagaacgagccgctgctgcgcgagatgttcgca
ctgcggcacgagctcgccaccctggtcggctacgccgactgggcgtcgtacgacgccggc
gtgaagatgatcggcgacggaccggcgatcccggcgttcatcgaccggatcgcggccgcc
gcggacgcgcccatgcggcgcgacctcgaccagctgctcgagcgctaccggcgcgatgtc
ccggacgcgaccgcgatcgacaccgcggactcgctgtactacgaggagctggtccgccag
gagcggcacgacgtcgacgcgcagcgggtccgggcgtacttcgacttcaccaaggtccgc
cgtggcctgctcgaggtcaccggccggctgttcgggctgcgctacgagccggtccccgac
gcgacggtctggcacgaggacgtcgcggcgtacgacgtgcttcgcgacgcccccgacggc
ccggtccccgtcgggcggatctacctggacctgcacccgcgcgagggcaagtacaagcac
gcggcgcagttcaccctcgtcgacgggctcgccgggcggcagctgcccgagggcgtgctg
gtgtgcaacttctcgcgcggcctgatggagcacgaccatgtggtcacgctgttccacgag
ttcgggcatctggtccaccacgtgctcggcggccacggcgggtggacccgcttctccggg
gtcgcgaccgagtgggacttcgtcgaggcgcccagccagctgctcgaggagtgggcgtgg
gaccccgaggtgctgcgcaccttcgccgccgacgccgacggcgagccgatcccggaggac
ctggtggagcggatgcgggccgccgacgagttcggcaagggctaccacgcgcgcacccag
atgttctacgcggcgatgtcgtactggttccacacgtcgcgtcccgacgacctgaccgcg
gcgatgcgcgagctgcaggagcgctactcgccgttcccctacatcgacggcacccacatg
ttcgcgagcttcggccacctcggcggctactcctcggcgtactacacctacatgtggtcg
ctggtgatcgcgaaggacctgttctccgccttcgaccccgccgatctcttcgacccggtc
gtcgccggtcgctaccgcgaccgcgtgctcgccctcggcggctcccgggacgccgccgac
ctggtcaccgacttcctcggccgcccctacaccttcgacgcgtacgccgcctggctcgct
cgctag

DBGET integrated database retrieval system