KEGG   Niveispirillum cyanobacteriorum: C0V82_24470Help
Entry
C0V82_24470       CDS       T05262                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
ncb  Niveispirillum cyanobacteriorum
Pathway
ncb00520  Amino sugar and nucleotide sugar metabolism
ncb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C0V82_24470
Enzymes [BR:ncb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     C0V82_24470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short
Motif
Other DBs
NCBI-ProteinID: AUN33502
UniProt: A0A2K9NKA6
Position
unnamed1:846872..847831
Genome map
AA seq 319 aa AA seqDB search
MKRARKRVLVAGGAGFLGSHLCERLLNDGHEVLCVDNFFTGSRENIRHLIPNPYFEVMRH
DVTFPLFVEVDEIYNLACPASPIHYQFNPVQTTKTSVHGAINMLGLAKRTKAKIFQASTS
EVYGDPTVHPQTEDYRGNVNPIGPRACYDEGKRCAETLFFDYHRQNGVNIRVARIFNTYG
PRMHPNDGRVVSNFIVQALQGNPITIYGEGTQTRSFCYVDDLIEGFIRLMAAPDEVTGPI
NIGNPGEYTIRQLAENVVRLTGAKSEFVWKPLPQDDPLQRCPDITKAKTLLNWQPTIHLE
EGLTRTIAYFADQLGVSLA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgcacgcaagcgggtattggtggctggtggtgccggtttcctgggttcacac
ctgtgcgaacgactgctgaatgacggacacgaggtgctgtgcgtcgataatttcttcacc
ggctcgcgggagaatatccggcacctgatcccaaacccctattttgaggtgatgcgccac
gacgtcaccttcccgctctttgtagaggtggatgagatctacaatctcgcctgccccgca
tcgcccatccattatcagttcaacccagtgcagacgacgaagacctctgtccatggggcc
atcaacatgctgggactggccaagcgaaccaaggccaaaatattccaggccagcacgtcg
gaggtttacggcgacccgacagtgcacccgcagaccgaggattatcgcggcaacgtgaac
ccaatcgggccccgcgcctgctatgacgagggaaagcgctgcgcggaaaccctgttcttc
gactatcatcgccagaatggcgtcaatatccgcgtggcccgcatcttcaacacctatggc
ccacgcatgcaccccaatgacgggcgcgtggtgtcgaacttcatcgtgcaggccctgcag
ggcaatccgatcaccatctatggcgagggcacccagacccggtcgttctgctatgtcgat
gatctgatcgagggtttcatccgtctgatggccgccccggatgaggtgaccggccccatc
aatatcggcaatcccggcgaatacacgatccgtcagctggcggagaatgtagtgcggtta
acgggcgccaaatcggagttcgtctggaaacccctgccgcaggacgacccgctgcagcgc
tgccccgacatcaccaaggccaaaaccctcctaaactggcagccgaccatccatctggag
gaaggcttgacgcgcaccatcgcctatttcgccgatcaactgggcgtgtccctggcctga

DBGET integrated database retrieval system